Overview

  • Product name
    Anti-Retinoid X Receptor alpha antibody
    See all Retinoid X Receptor alpha primary antibodies
  • Description
    Mouse polyclonal to Retinoid X Receptor alpha
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human Retinoid X Receptor alpha aa 1-462. (NP_002948.1)
    Sequence:

    MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSP ISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP VSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVY SCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGM KREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYV EANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVL TELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASL EAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTF LMEMLEAPHQMT


    Database link: P19793

  • Positive control
    • Lysate from 293T cells transfected with Retinoid X Receptor alpha

Applications

Our Abpromise guarantee covers the use of ab172316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa.

Target

  • Function
    Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. The high affinity ligand for RXRs is 9-cis retinoic acid. RXRA serves as a common heterodimeric partner for a number of nuclear receptors. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone acetylation, chromatin condensation and transcriptional suppression. On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation. The RXRA/PPARA heterodimer is required for PPARA transcriptional activity on fatty acid oxidation genes such as ACOX1 and the P450 system genes.
  • Tissue specificity
    Highly expressed in liver, also found in lung, kidney and heart.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain
    Composed of three domains: a modulating N-terminal domain (AF1 domain), a DNA-binding domain and a C-terminal ligand-binding domain (AF2 domain).
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues mainly in the N-terminal modulating domain. Constiutively phosphorylated on Ser-21 in the presence or absence of ligand. Under stress conditions, hyperphosphorylated by activated JNK on Ser-56, Ser-70, Thr-82 and Ser-260 (By similarity). Phosphorylated on Ser-27, in vitro, by PKA. This phosphorylation is required for repression of cAMP-mediated transcriptional activity of RARA.
    Sumoylation negatively regulates transcriptional activity. Desumoylated specifically by SENP6.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ00280 antibody
    • FLJ00318 antibody
    • FLJ16020 antibody
    • FLJ16733 antibody
    • MGC102720 antibody
    • NR2B1 antibody
    • Nuclear receptor subfamily 2 group B member 1 antibody
    • OTTHUMP00000022510 antibody
    • Retinoic acid receptor RXR alpha antibody
    • Retinoic acid receptor RXR-alpha antibody
    • Retinoid X nuclear receptor alpha antibody
    • Retinoid X receptor alpha antibody
    • RXR alpha1 antibody
    • Rxra antibody
    • RXRA_HUMAN antibody
    • RXRalpha1 antibody
    see all

Images

  • All lanes : Anti-Retinoid X Receptor alpha antibody (ab172316) at 1 µg/ml

    Lane 1 : Lysate from 293T cells transfected with Retinoid X Receptor alpha
    Lane 2 : Lysate from non-transfected 293T cells

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 51 kDa

References

ab172316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up