Overview

  • Product name

    Anti-Retinoid X Receptor beta/RXRB antibody
    See all Retinoid X Receptor beta/RXRB primary antibodies
  • Description

    Rabbit polyclonal to Retinoid X Receptor beta/RXRB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Retinoid X Receptor beta/RXRB aa 20-83.
    Sequence:

    GPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAG RDGMGDSGRDSRSP


    Database link: NP_068811

  • Positive control

    • A431 whole cell lysate
  • General notes

     This product was previously labelled as Retinoid X Receptor beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab96824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 57 kDa.

Target

  • Relevance

    Retinoid X receptors (RXRs) are members of the steroid/thyroid hormone receptor superfamily of nuclear receptor proteins which exert their effects by binding to specific DNA response elements, thus regulating gene expression in target cells. The RXR subfamily consists of at least three similar genes, RXR alpha, RXR beta and RXR gamma, all of which control transcription of target genes mediated by retinoids. RXR beta controls expression of many genes that respond to hormones and vitamins, including thyroid hormone, estrogen, retinoids and vitamin D. RXR beta controls a wide array of genes because of its ability to heterodimerize with other hormone receptors including the thyroid hormone receptor (THR), vitamin D receptor (VDR) and retinoic acid receptor (RAR).
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • DAUD I6 antibody
    • DAUDI6 antibody
    • H 2RIIBP antibody
    • H2RIIBP antibody
    • MGC1831 antibody
    • MHC class I promoter binding protein antibody
    • NR2B2 antibody
    • nuclear receptor subfamily 2 group B member 2 antibody
    • RCoR 1 antibody
    • RCoR1 antibody
    • Retinoic acid receptor RXR beta antibody
    • RXR beta antibody
    • RXRB antibody
    • RXRbeta antibody
    see all

Images

  • Anti-Retinoid X Receptor beta/RXRB antibody (ab96824) at 1/1000 dilution + A431 whole cell lysate at 30 µg

    Predicted band size: 57 kDa



    7.5% SDS-PAGE

References

ab96824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up