Overview

  • Product name

    Anti-Retinol Binding Protein RBP antibody [G4E4]
    See all Retinol Binding Protein RBP primary antibodies
  • Description

    Mouse monoclonal [G4E4] to Retinol Binding Protein RBP
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, IP, IHC-Fr, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Rabbit, Goat, Human, Monkey
  • Immunogen

    Full length native protein (purified) corresponding to Human Retinol Binding Protein RBP aa 1-201. P02753, P09455 and P50120
    Sequence:

    MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP EGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTED PAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADS YSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNL L


    Database link: P02753

  • Positive control

    • Liver & placenta

Properties

Applications

Our Abpromise guarantee covers the use of ab190700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 2 µg/ml.
IP Use at 2-4 µg/mg of lysate.
IHC-Fr Use a concentration of 1 - 2 µg/ml.
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 21-25 kDa.

Target

References

ab190700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Placenta)
Antigen retrieval step
None
Permeabilization
No
Specification
Placenta
Blocking step
(agent) for 1 hour(s) and 0 minute(s) · Temperature: 25°C
Fixative
Formalin

Alessandro Bombonati

Verified customer

Submitted Jun 06 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up