Overview

  • Product name

    Anti-Retinol dehydrogenase 16 antibody
    See all Retinol dehydrogenase 16 primary antibodies
  • Description

    Rabbit polyclonal to Retinol dehydrogenase 16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Retinol dehydrogenase 16 aa 198-265.
    Sequence:

    GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYK KSAEQMEQKCTQDLSLVT


    Database link: O75452

  • Positive control

    • IHC-P: Human liver tissue. WB: Human liver tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 36 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Oxidoreductase with a preference for NAD. Oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. Has higher activity towards CRBP-bound retinol than with free retinol. Oxidizes 3-alpha-hydroxysteroids. Oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. Can also catalyze the reverse reaction.
  • Tissue specificity

    Highly expressed in adult liver (at protein level). Detected in endometrium, liver and foreskin. Detected in the spineous layers of adult skin, and at lower levels in basal and granular skin layers. Detected in fetal liver and lung.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Post-translational
    modifications

    Not N-glycosylated.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Microsomal NAD(+)-dependent retinol dehydrogenase 4 antibody
    • Microsomal NAD+ dependent retinol dehydrogenase 4 antibody
    • RDH 16 antibody
    • RDH16 antibody
    • RDH16_HUMAN antibody
    • Retinol dehydrogenase 16 (all trans and 13 cis) antibody
    • Retinol dehydrogenase 16 (all trans) antibody
    • Retinol dehydrogenase 16 antibody
    • RODH 4 antibody
    • RoDH-4 antibody
    • SDR9C8 antibody
    • Short chain dehydrogenase/reductase family 9C member 8 antibody
    • Sterol/retinol dehydrogenase antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for Retinol dehydrogenase 16 using ab224163 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-Retinol dehydrogenase 16 antibody (ab224163) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 36 kDa

References

ab224163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up