Anti-Rex1 antibody [5E11E7] (ab175431)
Key features and details
- Mouse monoclonal [5E11E7] to Rex1
- Suitable for: IHC-P, WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Rex1 antibody [5E11E7]
See all Rex1 primary antibodies -
Description
Mouse monoclonal [5E11E7] to Rex1 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human Rex1 aa 249-310. (Expressed in E.coli).
Sequence:FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK
Database link: Q96MM3 -
Positive control
- Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabiliser. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
5E11E7 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175431 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/200 - 1/1000.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 35 kDa.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
IHC-P
1/200 - 1/1000. |
WB
1/500 - 1/2000. Predicted molecular weight: 35 kDa. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Involved in self-renewal property of ES cells (By similarity). May be involved in transcriptional regulation. -
Tissue specificity
Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed in embryonic stem cells, kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells. Expressed in embryonal carcinomas, seminomas, malignant kidney and several carcinoma cell lines. -
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Contains 4 C2H2-type zinc fingers. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 132625 Human
- Omim: 614572 Human
- SwissProt: Q96MM3 Human
- Unigene: 335787 Human
-
Alternative names
- hREX-1 antibody
- Reduced Expression 1 Protein antibody
- Reduced expression protein 1 antibody
see all
Images
-
All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : Rex1 (aa 249-310) - hIgGFc transfected HEK293 cell lysate
Predicted band size: 35 kDa -
Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution + Rex1 recombinant protein
Predicted band size: 35 kDaExpected MWt is 32.7 kDa.
-
All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution
Lane 1 : Jurkat cell lysate
Lane 2 : HEK293 cell lysate
Lane 3 : Raji cell lysate
Lane 4 : PC-3 cell lysate
Predicted band size: 35 kDa -
Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
-
Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
-
Flow cytometric analysis of HEK293 cells labeling Rex1 with ab175431 at 1/200 dilution (green) compared to a negative control (red).
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175431 has been referenced in 1 publication.
- Naeem A et al. Expansion of human amniotic epithelial cells using condition cell reprogramming technology. Hum Cell 36:602-611 (2023). PubMed: 36586053