Anti-Rex1 antibody [5E11E7] (ab175431)

Submit a review Submit a question

Overview

  • Product name

    Anti-Rex1 antibody [5E11E7]
    See all Rex1 primary antibodies

  • Description

    Mouse monoclonal [5E11E7] to Rex1

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human Rex1 aa 249-310. (Expressed in E.coli).
    Sequence:

    FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK


    Database link: Q96MM3

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabiliser.
  • Concentration information loading...

  • Purity

    Protein G purified

  • Purification notes

    Purified from tissue culture supernatant.

  • Clonality

    Monoclonal

  • Clone number

    5E11E7

  • Isotype

    IgG1

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Involved in self-renewal property of ES cells (By similarity). May be involved in transcriptional regulation.

  • Tissue specificity

    Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed in embryonic stem cells, kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells. Expressed in embryonal carcinomas, seminomas, malignant kidney and several carcinoma cell lines.

  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    • Alternative names

      • hREX-1 antibody
      • Reduced Expression 1 Protein antibody
      • Reduced expression protein 1 antibody
      • Rex-1 antibody
      • REX1 antibody
      • REX1 transcription factor antibody
      • Zfp-42 antibody
      • Zfp42 antibody
      • ZFP42 zinc finger protein antibody
      • ZFP42_HUMAN antibody
      • Zinc finger protein 42 homolog antibody
      • Zinc finger protein 754 antibody
      • ZNF754 antibody
      see all

    Images

    • Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)
      Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)
      All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution

      Lane 1 : HEK293 cell lysate
      Lane 2 : Rex1 (aa 249-310) - hIgGFc transfected HEK293 cell lysate

      Predicted band size: 35 kDa

    • Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)
      Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)
      Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution + Rex1 recombinant protein

      Predicted band size: 35 kDa



      Expected MWt is 32.7 kDa.

    • Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)
      Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)
      All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution

      Lane 1 : Jurkat cell lysate
      Lane 2 : HEK293 cell lysate
      Lane 3 : Raji cell lysate
      Lane 4 : PC-3 cell lysate

      Predicted band size: 35 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)

      Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)

      Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.

    • Flow Cytometry - Anti-Rex1 antibody [5E11E7] (ab175431)
      Flow Cytometry - Anti-Rex1 antibody [5E11E7] (ab175431)

      Flow cytometric analysis of HEK293 cells labeling Rex1 with ab175431 at 1/200 dilution (green) compared to a negative control (red).

    References

    ab175431 has not yet been referenced specifically in any publications.

    Publishing research using ab175431? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab175431.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up