Name: Anti-Rex1 antibody [5E11E7]
SKU: ab175431

Product name

Anti-Rex1 antibody [5E11E7]
See all Rex1 primary antibodies
Description

Mouse monoclonal [5E11E7] to Rex1
Host species

Mouse
Tested applications

Suitable for: IHC-P, WB, Flow Cytmore details
Species reactivity

Reacts with: Human
Immunogen

Recombinant fragment corresponding to Human Rex1 aa 249-310. (Expressed in E.coli).
Sequence:
FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK

Database link: Q96MM3

Run BLAST with Run BLAST with
Positive control
- Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

Preservative: 0.05% Sodium azide
Constituent: 99% PBS

Contains 0.5% protein stabiliser.
Concentration information loading...
Purity

Protein G purified
Purification notes

Purified from tissue culture supernatant.
Clonality

Monoclonal
Clone number

5E11E7
Isotype

IgG1
Research areas

Our Abpromise guarantee covers the use of ab175431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application

Abreviews

Notes

IHC-P

1/200 - 1/1000.

WB

1/500 - 1/2000. Predicted molecular weight: 35 kDa.

Flow Cyt

1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Function

Involved in self-renewal property of ES cells (By similarity). May be involved in transcriptional regulation.
Tissue specificity

Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed in embryonic stem cells, kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells. Expressed in embryonal carcinomas, seminomas, malignant kidney and several carcinoma cell lines.
Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.
Contains 4 C2H2-type zinc fingers.
Cellular localization

Nucleus.
Target information above from: UniProt accession Q96MM3 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 132625 Human
- Omim: 614572 Human
- SwissProt: Q96MM3 Human
- Unigene: 335787 Human
Alternative names
- hREX-1 antibody
- Reduced Expression 1 Protein antibody
- Reduced expression protein 1 antibody
- Rex-1 antibody
- REX1 antibody
- REX1 transcription factor antibody
- Zfp-42 antibody
- Zfp42 antibody
- ZFP42 zinc finger protein antibody
- ZFP42_HUMAN antibody
- Zinc finger protein 42 homolog antibody
- Zinc finger protein 754 antibody
- ZNF754 antibody
see all

Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)

All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution

Lane 1 : HEK293 cell lysate
Lane 2 : Rex1 (aa 249-310) - hIgGFc transfected HEK293 cell lysate

Predicted band size: 35 kDa
Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)

Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution + Rex1 recombinant protein

Predicted band size: 35 kDa

Expected MWt is 32.7 kDa.
Western blot - Anti-Rex1 antibody [5E11E7] (ab175431)

All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution

Lane 1 : Jurkat cell lysate
Lane 2 : HEK293 cell lysate
Lane 3 : Raji cell lysate
Lane 4 : PC-3 cell lysate

Predicted band size: 35 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)

Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)

Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
Flow Cytometry - Anti-Rex1 antibody [5E11E7] (ab175431)

Flow cytometric analysis of HEK293 cells labeling Rex1 with ab175431 at 1/200 dilution (green) compared to a negative control (red).

ab175431 has not yet been referenced specifically in any publications.

Publishing research using ab175431? Please let us know so that we can cite the reference in this datasheet.

Anti-Rex1 antibody [5E11E7] (ab175431)

Customer reviews and Q&As