Anti-Rex1 antibody [5E11E7] (ab175431)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-Rex1 antibody [5E11E7]
See all Rex1 primary antibodies -
DescriptionMouse monoclonal [5E11E7] to Rex1
-
Host speciesMouse
-
Tested applicationsSuitable for: IHC-P, WB, Flow Cytmore details
-
Species reactivityReacts with: Human
-
Immunogen
Recombinant fragment corresponding to Human Rex1 aa 249-310. (Expressed in E.coli).
Sequence:FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK
Database link: Q96MM3 -
Positive control
- Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferPreservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabiliser. -
Concentration information loading...
-
PurityProtein G purified
-
Purification notesPurified from tissue culture supernatant.
-
ClonalityMonoclonal
-
Clone number5E11E7
-
IsotypeIgG1
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab175431 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/1000. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 35 kDa. | |
Flow Cyt | 1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
|
Target
-
FunctionInvolved in self-renewal property of ES cells (By similarity). May be involved in transcriptional regulation.
-
Tissue specificityExpressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed in embryonic stem cells, kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells. Expressed in embryonal carcinomas, seminomas, malignant kidney and several carcinoma cell lines.
-
Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
Contains 4 C2H2-type zinc fingers. -
Cellular localizationNucleus.
- Information by UniProt
-
Database links
- Entrez Gene: 132625 Human
- Omim: 614572 Human
- SwissProt: Q96MM3 Human
- Unigene: 335787 Human
-
Alternative names
- hREX-1 antibody
- Reduced Expression 1 Protein antibody
- Reduced expression protein 1 antibody
see all
Images
-
All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : Rex1 (aa 249-310) - hIgGFc transfected HEK293 cell lysate
Predicted band size: 35 kDa -
Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution + Rex1 recombinant protein
Predicted band size: 35 kDaExpected MWt is 32.7 kDa.
-
All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution
Lane 1 : Jurkat cell lysate
Lane 2 : HEK293 cell lysate
Lane 3 : Raji cell lysate
Lane 4 : PC-3 cell lysate
Predicted band size: 35 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)
Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rex1 antibody [5E11E7] (ab175431)
Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.
-
Flow cytometric analysis of HEK293 cells labeling Rex1 with ab175431 at 1/200 dilution (green) compared to a negative control (red).
Datasheets and documents
References
ab175431 has not yet been referenced specifically in any publications.