Overview

  • Product name
    Anti-Rex1 antibody [5E11E7]
    See all Rex1 primary antibodies
  • Description
    Mouse monoclonal [5E11E7] to Rex1
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Rex1 aa 249-310. (Expressed in E.coli).
    Sequence:

    FEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILT HANTNKNEQEGK


    Database link: Q96MM3

  • Positive control
    • Rex 1 recombinant protein; Rex1 (aa249-310) - hIgGFc transfected HEK293 cell lysate; Jurkat, Raji, HEK293 and PC-3 cell lysates; HEK293 cells; Human rectum cancer tissue; Human esophagus cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabiliser.
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    Purified from tissue culture supernatant.
  • Clonality
    Monoclonal
  • Clone number
    5E11E7
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Involved in self-renewal property of ES cells (By similarity). May be involved in transcriptional regulation.
  • Tissue specificity
    Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed in embryonic stem cells, kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells. Expressed in embryonal carcinomas, seminomas, malignant kidney and several carcinoma cell lines.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • hREX-1 antibody
    • Reduced Expression 1 Protein antibody
    • Reduced expression protein 1 antibody
    • Rex-1 antibody
    • REX1 antibody
    • REX1 transcription factor antibody
    • Zfp-42 antibody
    • Zfp42 antibody
    • ZFP42 zinc finger protein antibody
    • ZFP42_HUMAN antibody
    • Zinc finger protein 42 homolog antibody
    • Zinc finger protein 754 antibody
    • ZNF754 antibody
    see all

Images

  • All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Rex1 (aa 249-310) - hIgGFc transfected HEK293 cell lysate

    Predicted band size: 35 kDa

  • Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution + Rex1 recombinant protein

    Predicted band size: 35 kDa



    Expected MWt is 32.7 kDa.

  • All lanes : Anti-Rex1 antibody [5E11E7] (ab175431) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : HEK293 cell lysate
    Lane 3 : Raji cell lysate
    Lane 4 : PC-3 cell lysate

    Predicted band size: 35 kDa

  • Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Rex1 with ab175431 at 1/200 dilution with DAB staining.

  • Flow cytometric analysis of HEK293 cells labeling Rex1 with ab175431 at 1/200 dilution (green) compared to a negative control (red).

References

ab175431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up