Overview

  • Product name

    Anti-REXO1 antibody
  • Description

    Rabbit polyclonal to REXO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human REXO1 aa 217-303.
    Sequence:

    PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSE PYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT


    Database link: Q8N1G1

  • Positive control

    • IHC-P: Human rectum tissue. WB: Human plasma.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.

Target

  • Relevance

    REXO1 or Elongin A-binding protein 1 (EloA-BP1) is an exonuclease domain-containing protein that can bind to Elongin. The Elongin complex stimulates the rate of transcription elongation by RNA polymerase II by suppressing the transient pausing of the polymerase at many sites along the DNA template. REXO1 is composed of 1221 amino acids and its mRNA is ubiquitously expressed. EloA-BP1 is capable of binding not only the NH(2)-terminal approximately 120 amino acid region of Elongin A, but also that of SII. Although REXO1 had no detectable effect on the rate of transcription elongation in vitro, it may play some role in the regulation of elongation in vivo.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • EloA BP1 antibody
    • ELOABP1 antibody
    • Elongin A binding protein 1 antibody
    • KIAA1138 antibody
    • REX1, RNA exonuclease 1 homolog (S. cerevisiae) antibody
    • RNA exonuclease 1 homolog antibody
    • TCEB3BP1 antibody
    • Transcription elongation factor B polypeptide 3 binding protein 1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for REXO1 with ab243536 at a 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-REXO1 antibody (ab243536) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver
    Lane 5 : Human tonsil

References

ab243536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up