Overview

  • Product name

  • Description

    Rabbit polyclonal to REXO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Sheep, Horse, Cow, Cat, Dog, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human REXO2 aa 187-237 (C terminal). The exact sequence is proprietary.
    Sequence:

    APKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTV S


    Database link: Q9Y3B8

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab206694 was affinity purified using an epitope specific to REXO2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab206694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 27 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-REXO2 antibody (ab206694) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 27 kDa


    Exposure time: 10 seconds


    Lysates prepared using NETN lysis buffer.

  • Detection of REXO2 in immunoprecipitates of 293T whole cell lysates prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab206694 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab206694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up