Anti-RFC4 antibody [OTI1A8] (ab156780)
Key features and details
- Mouse monoclonal [OTI1A8] to RFC4
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-RFC4 antibody [OTI1A8]
See all RFC4 primary antibodies -
Description
Mouse monoclonal [OTI1A8] to RFC4 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Dog, Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human RFC4 aa 1-363. Produced in HEK-293T cells (NP_002907).
Sequence:MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVD EVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPEL FRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILD EADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFK PLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATR LTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC
Database link: P35249 -
Positive control
- WB: HEK-293T cells lysate transfected with pCMV6-ENTRY RFC4 cDNA; HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 cell extracts. IHC-P: Human pancreas, pancreas carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY RFC4 cDNA.
-
General notes
Clone OTI1A8 (formerly 1A8).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI1A8 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab156780 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/200 - 1/4000. Predicted molecular weight: 40 kDa.
|
|
IHC-P |
1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
ICC/IF |
1/100.
|
Notes |
---|
WB
1/200 - 1/4000. Predicted molecular weight: 40 kDa. |
IHC-P
1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
1/100. |
Target
-
Function
The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template. -
Sequence similarities
Belongs to the activator 1 small subunits family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 478667 Dog
- Entrez Gene: 5984 Human
- Entrez Gene: 106344 Mouse
- Entrez Gene: 288003 Rat
- Omim: 102577 Human
- SwissProt: P35249 Human
- SwissProt: Q99J62 Mouse
- Unigene: 714318 Human
see all -
Alternative names
- A1 37 antibody
- A1 37 kDa subunit antibody
- Activator 1 37 antibody
see all
Images
-
All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY RFC4 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 40 kDa -
All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 40 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
Paraffin-embedded human pancreas tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
Paraffin-embedded human pancreas carcinoma tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
Paraffin-embedded human tonsil tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY RFC4 cDNA using ab156780 at 1/100 dilution in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab156780 has not yet been referenced specifically in any publications.