For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    rfc4-antibody-oti1a8-ab156780.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA Synthesis Other
Share by email

Anti-RFC4 antibody [OTI1A8] (ab156780)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
  • Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
  • Immunocytochemistry/ Immunofluorescence - Anti-RFC4 antibody [OTI1A8] (ab156780)

Key features and details

  • Mouse monoclonal [OTI1A8] to RFC4
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Rat, Dog, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Protein
Recombinant Human RFC4 protein (ab125986)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-RFC4 antibody [OTI1A8]
    See all RFC4 primary antibodies
  • Description

    Mouse monoclonal [OTI1A8] to RFC4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, African green monkey
  • Immunogen

    Recombinant full length protein corresponding to Human RFC4 aa 1-363. Produced in HEK-293T cells (NP_002907).
    Sequence:

    MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVD EVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPEL FRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILD EADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFK PLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATR LTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC


    Database link: P35249
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cells lysate transfected with pCMV6-ENTRY RFC4 cDNA; HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 cell extracts. IHC-P: Human pancreas, pancreas carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY RFC4 cDNA.
  • General notes

    Clone OTI1A8 (formerly 1A8).

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1A8
  • Isotype

    IgG1
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA Synthesis
    • Other

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • Hep G2 whole cell lysate (ab166833)
    • MCF7 whole cell lysate (ab29537)
    • HeLa whole cell lysate (ab29545)
    • Jurkat whole cell lysate (ab30128)
    • Jurkat whole cell lysate (ab7899)
    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant Human RFC4 protein (ab125986)
  • Related Products

    • Recombinant Human RFC4 protein (ab125986)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab156780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
1/200 - 1/4000. Predicted molecular weight: 40 kDa.
IHC-P
1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF
1/100.
Notes
WB
1/200 - 1/4000. Predicted molecular weight: 40 kDa.
IHC-P
1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF
1/100.

Target

  • Function

    The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.
  • Sequence similarities

    Belongs to the activator 1 small subunits family.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P35249 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 478667 Dog
    • Entrez Gene: 5984 Human
    • Entrez Gene: 106344 Mouse
    • Entrez Gene: 288003 Rat
    • Omim: 102577 Human
    • SwissProt: P35249 Human
    • SwissProt: Q99J62 Mouse
    • Unigene: 714318 Human
    • Unigene: 386835 Mouse
    see all
  • Alternative names

    • A1 37 antibody
    • A1 37 kDa subunit antibody
    • Activator 1 37 antibody
    • Activator 1 37 kDa subunit antibody
    • Activator 1 subunit 4 antibody
    • Replication factor C 37 antibody
    • Replication factor C 37 kDa subunit antibody
    • Replication factor C subunit 4 antibody
    • Replication factor C4 antibody
    • RF-C 37 kDa subunit antibody
    • RFC 37 antibody
    • RFC37 antibody
    • RFC4 replication factor C (activator 1)4 37kDa antibody
    • RfC4 antibody
    • RFC4_HUMAN antibody
    see all

Images

  • Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY RFC4 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 40 kDa

  • Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (Canine kidney cell line) cell extract
    Lane 8 : PC12 (Rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 40 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)

    Paraffin-embedded human pancreas tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)

    Paraffin-embedded human pancreas carcinoma tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)

    Paraffin-embedded human tonsil tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.

  • Immunocytochemistry/ Immunofluorescence - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunocytochemistry/ Immunofluorescence - Anti-RFC4 antibody [OTI1A8] (ab156780)

    COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY RFC4 cDNA using ab156780 at 1/100 dilution in ICC/IF.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab156780? Please let us know so that we can cite the reference in this datasheet.

ab156780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab156780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.