Anti-RFC4 antibody [OTI1A8] (ab156780)

Submit a review Submit a question

Overview

  • Product name

    Anti-RFC4 antibody [OTI1A8]
    See all RFC4 primary antibodies

  • Description

    Mouse monoclonal [OTI1A8] to RFC4

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details

  • Species reactivity

    Reacts with: Mouse, Rat, Dog, Human, Monkey

  • Immunogen

    Recombinant full length protein corresponding to Human RFC4 aa 1-363. Produced in HEK-293T cells (NP_002907).
    Sequence:

    MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVD EVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPEL FRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILD EADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFK PLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATR LTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC


    Database link: P35249

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: HEK-293T cells lysate transfected with pCMV6-ENTRY RFC4 cDNA; HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12 and MCF7 cell extracts. IHC-P: Human pancreas, pancreas carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY RFC4 cDNA.

  • General notes

    Clone OTI1A8 (formerly 1A8).

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...

  • Purity

    Affinity purified

  • Purification notes

    Purified from cell culture supernatant.

  • Clonality

    Monoclonal

  • Clone number

    OTI1A8

  • Isotype

    IgG1

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab156780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/4000. Predicted molecular weight: 40 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/100.

Target

  • Function

    The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.

  • Sequence similarities

    Belongs to the activator 1 small subunits family.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • A1 37 antibody
    • A1 37 kDa subunit antibody
    • Activator 1 37 antibody
    • Activator 1 37 kDa subunit antibody
    • Activator 1 subunit 4 antibody
    • Replication factor C 37 antibody
    • Replication factor C 37 kDa subunit antibody
    • Replication factor C subunit 4 antibody
    • Replication factor C4 antibody
    • RF-C 37 kDa subunit antibody
    • RFC 37 antibody
    • RFC37 antibody
    • RFC4 replication factor C (activator 1)4 37kDa antibody
    • RfC4 antibody
    • RFC4_HUMAN antibody
    see all

Images

  • Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY RFC4 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 40 kDa

  • Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Western blot - Anti-RFC4 antibody [OTI1A8] (ab156780)
    All lanes : Anti-RFC4 antibody [OTI1A8] (ab156780) at 1/200 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (Canine kidney cell line) cell extract
    Lane 8 : PC12 (Rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 40 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)

    Paraffin-embedded human pancreas tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)

    Paraffin-embedded human pancreas carcinoma tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RFC4 antibody [OTI1A8] (ab156780)

    Paraffin-embedded human tonsil tissue stained for RFC4 using ab156780 at 1/150 dilution in immunohistochemical analysis.

  • Immunocytochemistry/ Immunofluorescence - Anti-RFC4 antibody [OTI1A8] (ab156780)
    Immunocytochemistry/ Immunofluorescence - Anti-RFC4 antibody [OTI1A8] (ab156780)

    COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY RFC4 cDNA using ab156780 at 1/100 dilution in ICC/IF.

References

ab156780 has not yet been referenced specifically in any publications.

Publishing research using ab156780? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab156780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com