Question (39254) | Anti-RFP antibody (ab28664)

Go to datasheet (ab28664)

Question

Here is the sequence. It would be great if you can check it.

Redstar2 Tag


GGAGCTGGAGCTGGTGCAGGTGCTGGTGCAATGAGTGCTTCTTCTGAAGATGTCATCACTGAATTCATGAGATTCAAGGTTAAAATGGAAGGTACTGTTAACGGCCACGAATTCGAAATCGAAGGTGAAGGTGAGGGTAGACCATATGAAGGTCACAACACAGTCAAGTTGAAGGTTACTAAGGGTGGTCCACTGCCATTCGCTTGGGACATCTTGTCTCCACAATTCCAATACGGTTCTAAGGTCTACGTCAAGCACCCAGCTGACATTCCAGACTACAAGAAGTTGTCCTTCCCAGAAGGTTTCAAGTGGGAAAGGATCATGAACTTCGAAGACGGTGGCGTTGTTACTGTTACTCAAGACTCCTCCTTGCAAGACGGTTGTTTCATCTACAAGGTCAAGCTCATTGGTGTCAACTTCCCATCTGACGGTCCAGTCATGCAAAAGAAGACTATGGGTTGGGAAGCTTCTACCGAACGTTTGTACCCAAGAGACGGTGTCTTGAAGGGTGAAATCCACAAGGCCTTGAAGTTGAAGGACGGTGGTCACTACTTGGTCGAATTCAAGTCTATCTACAAGGCCAAGAAGCAAGTCCAATTGCCAGGCTATTACTACGTTGACTCTAAGTTGGACATCATCTCTCACAACGAAGACTACACTATCGTCGAACAATACGAACGTACTGAAGGTAGACACCACTTGTTCTTGTAA

Answer

Thank you for your patience.

Using the Expasy translate tool, I converted the nucleotide sequence you provided to the following protein sequence:

GAGAGAGAGAMSASSEDVITEFMRFKVKMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVT
KGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERIMNFEDGGVVTVTQ
DSSLQDGCFIYKVKLIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGEIHKALKLKD
GGHYLVEFKSIYKAKKQVQLPGYYYVDSKLDIISHNEDYTIVEQYERTEGRHHLFL

Three of our RFP antibodies were raised against immunogen sequences that are 100% conserved in Redstar2: ab28664, ab40740, and ab41336. While we have not tested these antibodies for detecting Redstar2, it is very likely that they would be suitable for that purpose.

I hope this helps, please let me know if you need any additional information or assistance.

Sign up