Overview

  • Product name

  • Description

    Rabbit polyclonal to RFPL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RFPL2 aa 99-378.
    Sequence:

    SSCPVCSDYLEKPMSLECGCAVCLKCINSLQKEPHGEDLLCCCSSMVSRK NKIRRNRQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDANTANNF LLISDDLRSVRSGRIRQNRQDLAERFDVSVCILGSPRFTCGRHCWEVDVG TSTEWDLGVCRESVHRKGRIQLTTELGFWTVSLRDGGRLSATTVPLTFLF VDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSV PPNGDQGVLSICPLMNSGTTDAPVRPGEAK


    Database link: O75678

  • Positive control

    • WB: MCF7 whole cell lysate. IHC-P: Human brain and prostate tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230092 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 32,36,42 kDa).
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Seems to be expressed in prostate and less abundantly in adult brain, fetal liver, and fetal kidney.
  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
    Contains 1 RING-type zinc finger.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ret finger protein like 2 antibody
    • Ret finger protein-like 2 antibody
    • RFPL 2 antibody
    • RFPL2 antibody
    • RFPL2_HUMAN antibody
    • RING finger protein 79 antibody
    • RNF79 antibody
    see all

Images

  • Anti-RFPL2 antibody (ab230092) at 1/1000 dilution + MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 32,36,42 kDa
    Observed band size: 42 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human brain tissue stained for RFPL2 using ab230092 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for RFPL2 using ab230092 at 1/100 dilution in immunohistochemical analysis.

References

ab230092 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230092.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up