Overview

  • Product name

  • Description

    Rabbit polyclonal to RFRP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RFRP aa 105-176.
    Sequence:

    TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHS PCANDLFYSMTCQHQEIQNPDQ

  • Positive control

    • RT4, U-251 MG, Human Liver and Human Tonsil lysates, Human kidney tissue
  • General notes

    Previously labelled as NPVF.

Properties

Applications

Our Abpromise guarantee covers the use of ab122738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Neuropeptide RFRP-1 acts as a potent negative regulator of gonadotropin synthesis and secretion. Neuropeptides NPSF and NPVF efficiently inhibit forskolin-induced production of cAMP, but RFRP-2 shows no inhibitory activity. Neuropeptide RFRP-1 induces secretion of prolactin in rats. Neuropeptide NPVF blocks morphine-induced analgesia.
  • Tissue specificity

    Isoform 1 is specifically expressed in the retina. Neuropeptides RFRP-1 and NPVF are detected in the hypothalamus.
  • Sequence similarities

    Belongs to the FARP (FMRFamide related peptide) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C7orf9 antibody
    • Neuropeptide NPSF antibody
    • Neuropeptide NPVF antibody
    • Neuropeptide RFRP-1 antibody
    • Neuropeptide RFRP-2 antibody
    • Neuropeptide RFRP-3 antibody
    • Neuropeptide VF antibody
    • NPVF antibody
    • RFRP antibody
    • RFRP_HUMAN antibody
    see all

Images

  • All lanes : Anti-RFRP antibody (ab122738) at 1/250 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human Plasma lysate
    Lane 4 : Human Liver lysate
    Lane 5 : Human Tonsil lysate
  • ab122738 at 1/200 dilution staining RFRP in Paraffin-embedded Human kidney tissue by Immunohistochemistry.

References

ab122738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up