
  • Product name
  • Description
    Rabbit polyclonal to RFX1
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 900-949 (ETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE S) of Human RFX1 (NP_002909).

  • Positive control
    • Transfected 293T cell lysate



Our Abpromise guarantee covers the use of ab87171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 105 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Regulatory factor essential for MHC class II genes expression. Binds to the X boxes of MHC class II genes. Also binds to an inverted repeat (ENH1) required for hepatitis B virus genes expression and to the most upstream element (alpha) of the RPL30 promoter.
  • Sequence similarities
    Belongs to the RFX family.
    Contains 1 RFX-type winged-helix DNA-binding domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • AI047719 antibody
    • AI385641 antibody
    • EF-C antibody
    • EFC antibody
    • Enhancer factor C antibody
    • MHC class II regulatory factor RFX antibody
    • MHC class II regulatory factor RFX1 antibody
    • Regulatory factor X 1 antibody
    • Regulatory factor X, 1 (influences HLA class II expression) antibody
    • Regulatory factor X1 antibody
    • RFX antibody
    • RFX-1 antibody
    • Rfx1 antibody
    • RFX1_HUMAN antibody
    • Trans-acting regulatory factor 1 antibody
    • Transcription factor RFX1 antibody
    see all


  • Anti-RFX1 antibody (ab87171) at 1 µg/ml + Transfected 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 105 kDa
    Observed band size: 130 kDa (why is the actual band size different from the predicted?)
    Additional bands at: 55 kDa, 68 kDa, 70 kDa. We are unsure as to the identity of these extra bands.

    Gel concentration: 6-18%


ab87171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87171.
Please use the links above to contact us or submit feedback about this product.


Sign up