Overview

  • Product name

  • Description

    Rabbit polyclonal to RFX5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RFX5 aa 367-616.
    Sequence:

    LSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENRE VGIGGDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKR GRPRKKSGGSGERNSTPLKSAAAMESAQSSRLPWETWGSGGEGNSAGGAE RPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPLVPSKVS VIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP


    Database link: P48382-1

  • Positive control

    • IHC-P: Human colon cancer and placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Activates transcription from class II MHC promoters. Recognizes X-boxes. Mediates cooperative binding between RFX and NF-Y. RFX binds the X1 box of MHC-II promoters.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in RFX5 are a cause of bare lymphocyte syndrome type 2 (BLS2) [MIM:209920]; also known as hereditary MHC class II deficiency or HLA class II-deficient combined immunodeficiency. BLS2 is a severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.
  • Sequence similarities

    Belongs to the RFX family.
    Contains 1 RFX-type winged-helix DNA-binding domain.
  • Domain

    The N-terminus is required for dimer formation, association with RFXANK and RFXAP, assembly of the RFX complex, and for binding of this complex to its X box target site in the MHC-II promoter. The C-terminus mediates cooperative binding between the RFX complex and NF-Y.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA binding protein RFX 5 antibody
    • DNA binding protein RFX5 antibody
    • DNA-binding protein RFX5 antibody
    • Influences HLA class II expression antibody
    • Regulatory factor X 5 antibody
    • Regulatory factor X subunit 5 antibody
    • Regulatory factor X, 5 (influences HLA class II expression) antibody
    • RFX 5 antibody
    • RFX5 antibody
    • Rfx5 protein antibody
    • RFX5_HUMAN antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for RFX5 with ab239038 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for RFX5 with ab239038 at a 1/100 dilution in immunohistochemical analysis.

References

ab239038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up