Overview

  • Product name

    Anti-RFXANK antibody [OTI3E7]
    See all RFXANK primary antibodies
  • Description

    Mouse monoclonal [OTI3E7] to RFXANK
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human RFXANK aa 1-237. Produced in HEK293T cells.
    Sequence:

    MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPV NPEPDASVSSPQGSSLKHSTTLTNRQRGNEVSALPATLDCDNLVNKPDER GFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIV GLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSG YTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE


    Database link: NP_604389

  • Positive control

    • WB: pCMV6-ENTRY RFXANK cDNA transfected HEK-293T cell lysate. IHC-P: Human kidney, kidney carcinoma, ovary adenocarcinoma, pancreas, endometrium adenocarcinoma, bladder carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY RFXANK. Flow Cyt: HeLa and Jurkat cells.
  • General notes

    Clone OTI3E7 (formerly 3E7).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI3E7
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 24, 28 kDa.
ICC/IF 1/100.
Flow Cyt 1/100.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator (MHC2TA). May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters. Isoform RFX-B-delta5 is not involved in the positive regulation of MHC class II genes.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in RFXANK are a cause of bare lymphocyte syndrome type 2 (BLS2) [MIM:209920]; also known as hereditary MHC class II deficiency or HLA class II-deficient combined immunodeficiency. BLS2 is a severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.
  • Sequence similarities

    Contains 5 ANK repeats.
  • Domain

    The third ankyrin repeat is required for association with the two other RFX subunits; RFX5 and RFXAP.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANKRA1 antibody
    • Ankyrin repeat containing regulatory factor X associated protein antibody
    • Ankyrin repeat family A protein 1 antibody
    • BLS antibody
    • DNA-binding protein RFXANK antibody
    • F14150_1 antibody
    • MGC138628 antibody
    • Regulatory factor X associated ankyrin containing protein antibody
    • Regulatory factor X subunit B antibody
    • Regulatory factor X, ankyrin repeat containing antibody
    • Regulatory factor X-associated ankyrin-containing protein antibody
    • RFX Bdelta4 antibody
    • RFX-B antibody
    • RFXANK antibody
    • RFXB antibody
    • RFXB delta 4 antibody
    • RFXK_HUMAN antibody
    see all

Images

  • All lanes : Anti-RFXANK antibody [OTI3E7] (ab236408) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY RFXANK cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 24, 28 kDa

  • Paraffin-embedded human kidney tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney carcinoma tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for RFXANK using ab236408 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY RFXANK stained for RFXANK (green) using ab236408 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling RFXANK with ab226408 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cell line labeling RFXANK with ab226408 at 1/100 dilution (red) compared to a nonspecific negative control antibody (blue).

References

ab236408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up