Overview

  • Product name

    Anti-RG1 antibody
  • Description

    Rabbit polyclonal to RG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RG1 aa 900-1080.
    Sequence:

    SAFNSDTNRAPQNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTK SENICNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQT EEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSS ASTSLPVEESQAQGNESLFSKYTNSKIPYFL


    Database link: Q16821

  • Positive control

    • IHC-P: Human skeletal muscle and heart tissue.
  • General notes

    Previously labelled as PPP1R3A. 

Properties

Applications

Our Abpromise guarantee covers the use of ab230285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Seems to act as a glycogen-targeting subunit for PP1. PP1 is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Plays an important role in glycogen synthesis but is not essential for insulin activation of glycogen synthase.
  • Tissue specificity

    Skeletal muscle and heart.
  • Involvement in disease

    Diabetes mellitus, non-insulin-dependent
  • Sequence similarities

    Contains 1 CBM21 (carbohydrate binding type-21) domain.
  • Domain

    The CBM21 domain is known to be involved in the localization to glycogen and is characteristic of some regulatory subunit of phosphatase complexes.
  • Post-translational
    modifications

    Phosphorylation at Ser-46 by ISPK stimulates the dephosphorylation of glycogen synthase and phosphorylase kinase.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle antibody
    • Glycogen associated regulatory subunit of protein phosphatase 1 antibody
    • GM antibody
    • PP1G antibody
    • PPP1R3 antibody
    • PPP1R3A antibody
    • PPR3A_HUMAN antibody
    • Protein phosphatase 1 glycogen-associated regulatory subunit antibody
    • Protein phosphatase 1 glycogen-targeting subunit, muscle antibody
    • Protein phosphatase 1 regulatory subunit 3A antibody
    • Protein phosphatase 1 regulatory subunit GM antibody
    • protein phosphatase 1, regulatory (inhibitor) subunit 3A antibody
    • Protein phosphatase 1, regulatory subunit 3 antibody
    • Protein phosphatase type-1 glycogen targeting subunit antibody
    • RG1 antibody
    • Serine /threonine specific protein phosphatase antibody
    • Type 1 protein phosphatase skeletal muscle glycogen targeting subunit antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for RG1 using ab230285 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for RG1 using ab230285 at 1/100 dilution in immunohistochemical analysis.

References

ab230285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up