Overview

  • Product name

    Anti-RG9MTD1 antibody - C-terminal
  • Description

    Rabbit polyclonal to RG9MTD1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PINX1 aa 353-403 (C terminal). The exact sequence is proprietary. NCBI Accession No. NP_060289.2.
    Sequence:

    LDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAK T


    Database link: Q7L0Y3

  • Positive control

    • HeLa whole cell lysate prepared using NETN buffer.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab190262 was affinity purified using an epitope specific to RG9MTD1 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Relevance

      RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
    • Cellular localization

      Mitochondrial
    • Database links

    • Alternative names

      • 1300018J16Rik antibody
      • D16Ertd454e antibody
      • EC 2.1.1.- antibody
      • FLJ20432 antibody
      • HBV pre S2 trans regulated protein 2 antibody
      • MGC118020 antibody
      • MGC94708 antibody
      • Mitochondrial ribonuclease P protein 1 antibody
      • Mitochondrial RNase P protein 1 antibody
      • MRPP1 antibody
      • NY REN 49 antigen antibody
      • Renal carcinoma antigen NY REN 49 antibody
      • RNA (guanine 9) methyltransferase domain containing 1 antibody
      • RNA (guanine 9) methyltransferase domain containing protein 1 mitochondrial antibody
      • Rnmtd1 antibody
      see all

    Images

    • Immunoprecipitation analysis of HeLa whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) using: 1) ab190262 at 6 µg per reaction. 2) control IgG. For blotting ab190262  was used at 1 µg/ml. Chemiluminescence with an exposure time of 3 minutes.

    References

    ab190262 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab190262.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up