Overview

  • Product name

    Anti-RGC-32 antibody - C-terminal
    See all RGC-32 primary antibodies
  • Description

    Rabbit polyclonal to RGC-32 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human RGC-32 aa 98-137 (C terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    PTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM


    Database link: Q9H4X1

  • Positive control

    • IHC-P: Human kidney and rat brain tissues.
  • General notes

    Previously labelled as C13orf15. 

Properties

Applications

Our Abpromise guarantee covers the use of ab214294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Function: Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation. Tissue specificity: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon, breast, prostate, bladder, lung, and ovarian cancer tissues.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm › cytoskeleton › centrosome. Note: Cytoplasmic in unstimulated cells. Nuclear after activation by complement. Associated with the centrosome during prometaphase and metaphase.
  • Database links

  • Alternative names

    • bA157L14.2 antibody
    • C13orf15 antibody
    • Chromosome 13 open reading frame 15 antibody
    • KIAA0564 antibody
    • MGC87338 antibody
    • regulator of cell cycle antibody
    • Regulator of cell cycle RGCC antibody
    • Response gene to complement 32 antibody
    • Response gene to complement 32 protein antibody
    • RGC 32 antibody
    • RGC-32 antibody
    • RGC32 antibody
    • RGCC antibody
    • RGCC_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling RGC-32 using ab214294 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of paraffin-embedded human kidney tissue, labeling RGC-32 using ab214294 at a 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human kidney tissue, labeling RGC-32 using ab214294 at a 1/200 dilution.

References

ab214294 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up