Overview

  • Product name

    Anti-RGS16 antibody [OTI4E5]
  • Description

    Mouse monoclonal [OTI4E5] to RGS16
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human RGS16 aa 1-202. Produced in HEK293T cells (NP_002919).
    Sequence:

    MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSK ENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEE FKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATAT CFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPS HT


    Database link: O15492

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY RGS16 cDNA; SVT2 cell extract. IHC-P: Human breast, Kidney, Pancreas and Endometrium tissues. ICC/IF: COS7 cells transiently transfected with pCMV6-ENTRY RGS16. Flow: Jurkat cells.
  • General notes

     clone OTI4E5 (formerly 4E5)

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography
  • Clonality

    Monoclonal
  • Clone number

    OTI4E5
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab119424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.
IHC-P 1/150.
Flow Cyt 1/100.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ICC/IF 1/100.

Target

  • Function

    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. May play a role in regulating the kinetics of signaling in the phototransduction cascade.
  • Tissue specificity

    Abundantly expressed in retina with lower levels of expression in most other tissues.
  • Sequence similarities

    Contains 1 RGS domain.
  • Post-translational
    modifications

    Palmitoylated on Cys-2 and/or Cys-12.
    Phosphorylation on Tyr-168 upon EGFR stimulation. Enhanced GTPase accelerating (GAP) activity on G(i)-alpha.
  • Information by UniProt
  • Database links

  • Alternative names

    • A28 RGS14 antibody
    • A28 RGS14P antibody
    • A28-RGS14P antibody
    • HGNC:9997 antibody
    • hRGS-r antibody
    • OTTHUMP00000033147 antibody
    • Regulator of G protein signaling 16 antibody
    • Regulator of G protein signalling 16 antibody
    • Regulator of G-protein signaling 16 antibody
    • Retinal-specific RGS antibody
    • Retinally abundant regulator of G protein signaling antibody
    • Retinally abundant regulator of G-protein signaling antibody
    • RGS 16 antibody
    • RGS R antibody
    • RGS-R antibody
    • Rgs14 antibody
    • RGS16 antibody
    • RGS16_HUMAN antibody
    • RGSR antibody
    see all

Images

  • All lanes : Anti-RGS16 antibody [OTI4E5] (ab119424) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY RGS16 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 23 kDa

  • All lanes : Anti-RGS16 antibody [OTI4E5] (ab119424) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell lysate
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 7 : MDCK cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell lysate
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 23 kDa

  • Paraffin-embedded human breast tissue stained for RGS16 using ab119424 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for RGS16 using ab119424 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for RGS16 using ab119424 at 1/150 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human endometrium tissue stained for RGS16 using ab119424 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY RGS16, stained for RGS16 (green) using ab119424 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of jurkat (human T cell leukemia cell line from peripheral blood) cells staining RGS16 (red) using ab119424 at 1/100 dilution compared to a nonspecific negative control antibody (Blue).

References

ab119424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab119424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up