Anti-RHBDD1 antibody (ab220855)
Key features and details
- Rabbit polyclonal to RHBDD1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RHBDD1 antibody
See all RHBDD1 primary antibodies -
Description
Rabbit polyclonal to RHBDD1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human RHBDD1 aa 42-101.
Sequence:FLNPQKPLYSSCLSVEKCYQQKDWQRLLLSPLHHADDWHLYFNMASMLWK GINLERRLGS
Database link: Q8TEB9 -
Positive control
- U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220855 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Sequence similarities
Belongs to the peptidase S54 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 84236 Human
- Entrez Gene: 76867 Mouse
- Entrez Gene: 100172352 Orangutan
- SwissProt: Q8TEB9 Human
- SwissProt: Q8BHC7 Mouse
- SwissProt: Q5RBS4 Orangutan
- Unigene: 471514 Human
- Unigene: 226994 Mouse
-
Alternative names
- DKFZp547E052 antibody
- EC=3.4.21. antibody
- MGC117258 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-RHBDD1 antibody (ab220855)
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling RHBDD1 with ab220855 at 4 μg/ml (green).
Protocols
Datasheets and documents
References (0)
ab220855 has not yet been referenced specifically in any publications.
