Overview

  • Product name

  • Description

    Rabbit polyclonal to RHBDD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human RHBDD2 aa 208-281.
    Sequence:

    ERVALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQ SCHPHLSPSHPVSQTQHASGQKLA


    Database link: Q6NTF9

  • Positive control

    • Human cerebral cortex tissue; U-251 MG cells; RHBDD2 overexpression HEK293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185448 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 39 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunofluorescent analysis of PFA/Triton X-100-treated U-251 MG cells labeling RHBDD2 with ab185448 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling RHBDD2 with ab185448 at 1/200 dilution.

  • All lanes : Anti-RHBDD2 antibody (ab185448) at 1/100 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

    Predicted band size: 39 kDa

References

ab185448 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (RPE1)
Gel Running Conditions
Non-reduced Denaturing
Loading amount
20 µg
Specification
RPE1
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C

Abcam user community

Verified customer

Submitted May 28 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up