Overview

  • Product name

  • Description

    Rabbit polyclonal to RHCG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RHCG aa 31-61.
    Sequence:

    RYDFEADAHWWSERTHKNLSDMENEFYYRYP


    Database link: Q9UBD6

  • Positive control

    • Human tonsil tissue lysate, Human esophagus tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab187904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 53 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Functions as an electroneutral and bidirectional ammonium transporter. May regulate transepithelial ammonia secretion.
  • Tissue specificity

    Expressed in brain, testis, placenta, pancreas, esophagus and prostate. Expressed in squamous epithelial tissues (at protein level). According to PubMed:11062476, specifically expressed in kidney.
  • Sequence similarities

    Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
  • Developmental stage

    Specifically expressed in fetal kidney.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Apical cell membrane. Also detected at the basolateral membrane and in subapical vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ammonium transporter Rh type C antibody
    • C15orf6 antibody
    • CDRC2 antibody
    • chromosome 15 open reading frame 6 antibody
    • PDRC2 antibody
    • Rh family type C glycoprotein antibody
    • Rh glycoprotein kidney antibody
    • Rh type C glycoprotein antibody
    • rhcg antibody
    • RHCG_HUMAN antibody
    • Rhesus blood group family type C glycoprotein antibody
    • Rhesus blood group, C glycoprotein antibody
    • RHGK antibody
    • SLC42A3 antibody
    • Tumor-related protein DRC2 antibody
    see all

Images

  • All lanes : Anti-RHCG antibody (ab187904) at 1/100 dilution

    Lane 1 : Human cell line RT-4 lysate
    Lane 2 : Human cell line U-251MG sp lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa


    Exposure time: 1 minute
  • Immunohistochemical analysis of paraffin-embedded Human esophagus tissue labeling RHCG with ab187904 at 1/1000 dilution.

References

ab187904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up