Description

  • Product name

  • Accession

  • Animal free

    No
  • Nature

    Synthetic
    • Sequence

      WALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFL
    • Predicted molecular weight

      35 kDa

Associated products

Specifications

Our Abpromise guarantee covers the use of ab216161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form

    Lyophilised
  • Additional notes

    This is the blocking peptide for ab123028.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

  • Reconstitution
    Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS.

General Info

  • Alternative names

    • Blood group Rh(D) polypeptide
    • Blood group--Rhesus system D polypeptide
    • CD240D
    • D antigen (DCS)
    • DIIIc
    • MGC165007
    • RH
    • Rh blood group antigen Evans
    • Rh blood group D antigen
    • Rh polypeptide 2
    • RH30
    • Rh4
    • RHCED
    • Rhd
    • RHD_HUMAN
    • RhDCw
    • RHDel
    • RHDVA(TT)
    • Rhesus blood group D antigen allele DIII type 7
    • Rhesus D antigen
    • Rhesus system D polypeptide
    • RhII
    • RhK562-II
    • RhPI
    • RHPII
    • RHXIII
    see all
  • Function

    May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
  • Tissue specificity

    Restricted to tissues or cell lines expressing erythroid characters.
  • Sequence similarities

    Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab216161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up