Anti-Rho A + B + C antibody [1A11-4G10] (ab175328)

Overview

  • Product name
    Anti-Rho A + B + C antibody [1A11-4G10]
    See all Rho A + B + C primary antibodies
  • Description
    Mouse monoclonal [1A11-4G10] to Rho A + B + C
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IP, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Cow, Dog, Caenorhabditis elegans, Drosophila melanogaster, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Rho A + B + C aa 1-193.
    Sequence:

    MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL


    Database link: P61586

  • Positive control
    • HeLa, A431, HEK293T, U2OS and mouse NIH 3T3 cell lysates; mouse NIH 3T3 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.05% Sodium azide
    Constituents: 0.1% BSA, 30% Glycerol, 69% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    1A11-4G10
  • Isotype
    IgG1

Applications

Our Abpromise guarantee covers the use of ab175328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1500.
IP Use at 2 µg/mg of lysate.
ICC/IF 1/100 - 1/200.

Target

Images

  • All lanes : Anti-Rho A + B + C antibody [1A11-4G10] (ab175328) at 1/1000 dilution

    Lane 1 : HeLa cell lysate at 25 µg
    Lane 2 : A431 cell lysate at 25 µg
    Lane 3 : HEK293T cell lysate at 25 µg
    Lane 4 : U2OS cell lysate at 25 µg
    Lane 5 : Mouse NIH 3T3 cell lysate at 25 µg
    Lane 6 : Purified full length His-tagged Rho A at 0.5 µg
    Lane 7 : Purified truncated Rho B at 0.5 µg
    Lane 8 : Purified full length Rho C at 0.5 µg

    Secondary
    All lanes : Goat anti-mouse IgG-HRP at 1/15000 dilution

    Developed using the ECL technique.
  • Immunofluorescence analysis of formalin-fixed permeabilized mouse NIH 3T3 cells, labeling Rho A + B + C (green, left panel) using ab175328 at a 1/100 dilution followed by DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye (central panel).

  • Western blot analysis on immunoprecipitation pellet from HeLa cells. The antigen-antibody complex was formed by incubating 750 µg of HeLa cell lysate with 2 µg of ab175328 overnight at 4°C. The immune-complex was then captured on 50 µl of Protein A/G Plus Agarose, washed extensively and eluted in sample buffer. 1) 25 µg of HeLa cell lysate and 2) eluted sample were resolved on a SDS PAGE gel. The membrane was probed with ab175328 at a 1/1000 dilution. An anti-mouse IgG-HRP secondary antibody at a 1/2500 dilution was used. Chemiluminescent detection was perfomed.

References

ab175328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up