Anti-Rho A + B + C antibody [1A11-4G10] (ab175328)
Key features and details
- Mouse monoclonal [1A11-4G10] to Rho A + B + C
- Suitable for: ICC/IF
- Reacts with: Mouse
- Isotype: IgG1
Overview
-
Product name
Anti-Rho A + B + C antibody [1A11-4G10]
See all Rho A + B + C primary antibodies -
Description
Mouse monoclonal [1A11-4G10] to Rho A + B + C -
Host species
Mouse -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Chicken, Cow, Dog, Caenorhabditis elegans, Drosophila melanogaster, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human Rho A + B + C aa 1-193.
Sequence:MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Database link: P61586 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.1% BSA, 30% Glycerol (glycerin, glycerine), 69% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
1A11-4G10 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175328 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
1/10 - 1/100.
|
Notes |
---|
ICC/IF
1/10 - 1/100. |
Target
-
Cellular localization
Rho A: Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm; cytoskeleton. Rho B: Late endosome membrane; Lipid-anchor. Cell membrane; Lipid-anchor. Nucleus. Rho C: Cell membrane; Lipid-anchor; Cytoplasmic side. -
Database links
- Entrez Gene: 178458 Caenorhabditis elegans
- Entrez Gene: 395869 Chicken
- Entrez Gene: 338049 Cow
- Entrez Gene: 513152 Cow
- Entrez Gene: 403954 Dog
- Entrez Gene: 36775 Drosophila melanogaster
- Entrez Gene: 11848 Mouse
- Entrez Gene: 11852 Mouse
see all -
Alternative names
- AA017882 antibody
- AI324259, antibody
- Aplysia ras related homolog 9 (RhoC) antibody
see all
Images
-
Immunofluorescence analysis of formalin-fixed permeabilized mouse kidney tissue (right) compared to a negative control without primary antibody (left), labeling Rho A + B + C (green, left panel) using ab175328 at a 1/120 dilution followed by DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab175328 has not yet been referenced specifically in any publications.