Anti-RhoA + C antibody [1B34A10] (ab175359)
Key features and details
- Mouse monoclonal [1B34A10] to RhoA + C
- Suitable for: IP, ICC/IF, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-RhoA + C antibody [1B34A10] -
Description
Mouse monoclonal [1B34A10] to RhoA + C -
Host species
Mouse -
Tested applications
Suitable for: IP, ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human RhoA + C aa 1-193.
Sequence:MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Database link: P61586 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.1% BSA, 30% Glycerol (glycerin, glycerine), 69% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
1B34A10 -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175359 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP |
Use at an assay dependent concentration.
Use 2µg. |
|
ICC/IF |
1/100 - 1/200.
|
|
IHC-P |
1/100 - 1/200.
|
|
WB |
1/500 - 1/1500. Predicted molecular weight: 22 kDa.
|
Notes |
---|
IP
Use at an assay dependent concentration. Use 2µg. |
ICC/IF
1/100 - 1/200. |
IHC-P
1/100 - 1/200. |
WB
1/500 - 1/1500. Predicted molecular weight: 22 kDa. |
Target
-
Relevance
RhoA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. RhoC regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells. -
Cellular localization
RhoA: Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm; cytoskeleton. Cleavage furrow. Cytoplasm; cell cortex. Midbody. RhoC:Cell membrane; Lipid-anchor; Cytoplasmic side Potential. Cleavage furrow. -
Database links
- Entrez Gene: 387 Human
- Entrez Gene: 389 Human
- Entrez Gene: 11848 Mouse
- Entrez Gene: 11853 Mouse
- Omim: 165380 Human
- Omim: 165390 Human
- SwissProt: P08134 Human
- SwissProt: P61586 Human
see all -
Alternative names
- Aplysia ras-related homolog 12 antibody
- ARH12 antibody
- ARHA antibody
see all
Images
-
All lanes : Anti-RhoA + C antibody [1B34A10] (ab175359) at 1/1000 dilution
Lane 1 : SW 480 whole cell extract
Lane 2 : SK-OV-3 whole cell extract
Lane 3 : NIH-3T3 whole cell extract
Lane 4 : PC-12 whole cell extract
Lysates/proteins at 30 µg per lane.
Secondary
All lanes : Goat anti-Mouse IgG (H+L) Superclonal™ Secondary Antibody, HRP conjugate at 1/4000 dilution
Predicted band size: 22 kDa -
Immunofluorescent analysis of Rho A/C (green) showing staining in the in the cytoplasm of A431 cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with ab175359 in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4°C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.
-
Immunofluorescent analysis of Rho A/C (green) showing staining in the in the cytoplasm of Hela cells (right) compared to a negative control without primary antibody (left). Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with ab175359 in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4°C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI. Images were taken at a magnification of 60x.
-
Immunohistochemistry analysis of Rho A/C showing staining in the cytoplasm of paraffin-embedded human hepatocarcinoma (right) compared with a negative control without primary antibody (left). To expose target proteins, antigen retrieval was performed using 10mM sodium citrate (pH 6.0), microwaved for 8-15 min. Following antigen retrieval, tissues were blocked in 3% H2O2-methanol for 15 min at room temperature, washed with ddH2O and PBS, and then probed with ab175359 diluted in 3% BSA-PBS at a dilution of 1:200 overnight at 4°C in a humidified chamber. Tissues were washed extensively in PBST and detection was performed using an HRP-conjugated secondary antibody followed by colorimetric detection using a DAB kit. Tissues were counterstained with hematoxylin and dehydrated with ethanol and xylene to prep for mounting.
-
Immunohistochemistry analysis of Rho A/C showing staining in the cytoplasm and membrane of paraffin-embedded mouse liver tissue (right) compared with a negative control without primary antibody (left). To expose target proteins, antigen retrieval was performed using 10mM sodium citrate (pH 6.0), microwaved for 8-15 min. Following antigen retrieval, tissues were blocked in 3% H2O2-methanol for 15 min at room temperature, washed with ddH2O and PBS, and then probed with ab175359 diluted in 3% BSA-PBS at a dilution of 1:100 overnight at 4°C in a humidified chamber. Tissues were washed extensively in PBST and detection was performed using an HRP-conjugated secondary antibody followed by colorimetric detection using a DAB kit. Tissues were counterstained with hematoxylin and dehydrated with ethanol and xylene to prep for mounting.
-
mmunohistochemistry analysis of Rho A/C showing staining in the cytoplasm and membrane of paraffin-embedded human prostate carcinoma (right) compared with a negative control without primary antibody (left). To expose target proteins, antigen retrieval was performed using 10mM sodium citrate (pH 6.0), microwaved for 8-15 min. Following antigen retrieval, tissues were blocked in 3% H2O2-methanol for 15 min at room temperature, washed with ddH2O and PBS, and then probed with ab175359 diluted in 3% BSA-PBS at a dilution of 1:200 overnight at 4°C in a humidified chamber. Tissues were washed extensively in PBST and detection was performed using an HRP-conjugated secondary antibody followed by colorimetric detection using a DAB kit. Tissues were counterstained with hematoxylin and dehydrated with ethanol and xylene to prep for mounting.
-
All lanes : Anti-RhoA + C antibody [1B34A10] (ab175359) at 1/1000 dilution
Lane 1 : HeLa whole cell lysate at 25 µg
Lane 2 : A431 whole cell lysate at 25 µg
Lane 3 : HEK293T whole cell lysate at 25 µg
Lane 4 : U2 OS whole cell lysate at 25 µg
Lane 5 : NIH 3T3 whole cell lysate at 25 µg
Lane 6 : K562 whole cell lysate at 25 µg
Lane 7 : RhoA purified protein at 0.5 µg
Lane 8 : RhoB purified protein at 0.5 µg
Lane 9 : RhoC purified protein with proprietary tag at 0.5 µg
Secondary
All lanes : goat anti-mouse IgG-HRP at 1/15000 dilution
Developed using the ECL technique.
Predicted band size: 22 kDa -
Immunofluorescent analysis of HeLa cells (formalin-fixed, 0.1% Triton X-100 permeabilized) labeling RhoA + C with ab175359 at 1/100 dilution followed with DyLight 488 goat anti-mouse IgG secondary antibody at 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye.
-
Immunoprecipitation analysis of RhoA + C was performed on HeLa cells. Antigen-antibody complexes were formed by incubating 500μg of whole cell lysate with 2μg ab175359 (lane 2).
HeLa cell lysate was run as a control (lane 1).
For WB detection, ab175359 was used at 1/1000 dilution.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab175359 has not yet been referenced specifically in any publications.