Overview

  • Product name

    Anti-RhoA + C antibody [1B34A10]
  • Description

    Mouse monoclonal [1B34A10] to RhoA + C
  • Host species

    Mouse
  • Tested applications

    Suitable for: IP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human RhoA + C aa 1-193.
    Sequence:

    MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL


    Database link: P61586

  • Positive control

    • HeLa, A431, HEK293T, NIH 3T3, U2 OS and K562 whole cell lysates; RhoA and RhoC recombinant proteins; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab175359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.

Use 2μg.

ICC/IF 1/100 - 1/200.
WB 1/500 - 1/1500. Predicted molecular weight: 22 kDa.

Target

  • Relevance

    RhoA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. RhoC regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.
  • Cellular localization

    RhoA: Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm; cytoskeleton. Cleavage furrow. Cytoplasm; cell cortex. Midbody. RhoC:Cell membrane; Lipid-anchor; Cytoplasmic side Potential. Cleavage furrow.
  • Database links

  • Alternative names

    • Aplysia ras-related homolog 12 antibody
    • ARH12 antibody
    • ARHA antibody
    • h12 antibody
    • Oncogene RHO H12 antibody
    • Ras homolog family member A antibody
    • Ras homolog gene family, member A antibody
    • Rho cDNA clone 12 antibody
    • RHO12 antibody
    • RHOH12 antibody
    • Small GTP binding protein RhoA antibody
    • Transforming protein RhoA antibody
    see all

Images

  • All lanes : Anti-RhoA + C antibody [1B34A10] (ab175359) at 1/1000 dilution

    Lane 1 : HeLa whole cell lysate at 25 µg
    Lane 2 : A431 whole cell lysate at 25 µg
    Lane 3 : HEK293T whole cell lysate at 25 µg
    Lane 4 : U2 OS whole cell lysate at 25 µg
    Lane 5 : NIH 3T3 whole cell lysate at 25 µg
    Lane 6 : K562 whole cell lysate at 25 µg
    Lane 7 : RhoA purified protein at 0.5 µg
    Lane 8 : RhoB purified protein at 0.5 µg
    Lane 9 : RhoC purified protein with proprietary tag at 0.5 µg

    Secondary
    All lanes : goat anti-mouse IgG-HRP at 1/15000 dilution

    Developed using the ECL technique.

    Predicted band size: 22 kDa

  • Immunofluorescent analysis of HeLa cells (formalin-fixed, 0.1% Triton X-100 permeabilized) labeling RhoA + C with ab175359 at 1/100 dilution followed with DyLight 488 goat anti-mouse IgG secondary antibody at 1/400 dilution. Nuclei (blue) were stained with Hoechst 33342 dye.

  • Immunoprecipitation analysis of RhoA + C was performed on HeLa cells. Antigen-antibody complexes were formed by incubating 500μg of whole cell lysate with 2μg ab175359 (lane 2).

    HeLa cell lysate was run as a control (lane 1).

    For WB detection, ab175359 was used at 1/1000 dilution.

References

ab175359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up