Overview

  • Product name

  • Description

    Rabbit polyclonal to RHOC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RHOC aa 119-182.
    Sequence:

    KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGG AVPFSEIPKAFPTC


    Database link: Q5JR05

  • Positive control

    • Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aplysia RAS-related homolog 9 antibody
    • ARH 9 antibody
    • ARH9 antibody
    • ARHC antibody
    • H9 antibody
    • MGC1448 antibody
    • MGC61427 antibody
    • Oncogene RHO H9 antibody
    • Ras homolog gene family member C antibody
    • RAS related homolog 9 antibody
    • RHO C antibody
    • Rho cDNA clone 9 antibody
    • Rho related GTP binding protein RhoC antibody
    • Rho-related GTP-binding protein RhoC antibody
    • rhoC antibody
    • RhoC GTPase antibody
    • RHOC_HUMAN antibody
    • RHOH 9 antibody
    • RHOH9 antibody
    • Small GTP binding protein RhoC antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue, labeling RHOC using ab204312 at a 1/50 dilution.

References

ab204312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up