Overview

  • Product name

    Anti-Rhodopsin antibody [A531]
    See all Rhodopsin primary antibodies
  • Description

    Mouse monoclonal [A531] to Rhodopsin
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow, Human, Pig
    Predicted to work with: Sheep, Rabbit, Cat, Dog, Cynomolgus monkey, Chinese hamster
  • Immunogen

    Full length native protein (purified) corresponding to Cow Rhodopsin aa 1-348.
    Sequence:

    MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV TRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA


    Database link: P02699

  • Positive control

    • Bovine retinal extracts; Pig retinal tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab190307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/1000.
WB 1/5000. Use under non reducing condition. Detects a band of approximately 35,70,140 kDa (predicted molecular weight: 39 kDa).
IHC-P 1/1000.

Target

Images

  • Immunofluorescent analysis of pig retinal tissue labeling Rhodopsin with ab190307 at 1/1000 dilution (green) and counterstained with rabbit polyclonal antibody to neurofilament  (red) and DNA (blue).

    Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).

  • Anti-Rhodopsin antibody [A531] (ab190307) at 1/5000 dilution + Bovine retinal extract

    Predicted band size: 39 kDa



    Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin.

    Note, due to the highly hydrophobic nature of rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.

References

This product has been referenced in:

  • Cehofski LJ  et al. IL-18 and S100A12 Are Upregulated in Experimental Central Retinal Vein Occlusion. Int J Mol Sci 19:N/A (2018). Read more (PubMed: 30366444) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up