Overview

  • Product name

    Anti-RhoF antibody [1D4B6]
    See all RhoF primary antibodies
  • Description

    Mouse monoclonal [1D4B6] to RhoF
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human RhoF aa 1-84 (N terminal).
    Sequence:

    MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAP SVFEKYTASV TVGSKEVTLNLYDTAGQEDYDRLR


    Database link: Q9HBH0

  • Positive control

    • Recombinant Human RhoF protein, RohF transfected HEK293 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1D4B6
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.
Flow Cyt 1/200 - 1/400.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cell membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHF antibody
    • FLJ20247 antibody
    • Ras homolog gene family member F (in filopodia) antibody
    • Ras homolog gene family member F antibody
    • Rho F antibody
    • Rho family GTPase Rif antibody
    • Rho in filopodia antibody
    • Rho related GTP binding protein RhoF antibody
    • Rho-related GTP-binding protein RhoF antibody
    • Rhof antibody
    • RHOF_HUMAN antibody
    • RIF antibody
    see all

Images

  • Anti-RhoF antibody [1D4B6] (ab201976) at 1/500 dilution + RhoF recombinant protein

    Predicted band size: 24 kDa

  • All lanes : Anti-RhoF antibody [1D4B6] (ab201976) at 1/500 dilution

    Lane 1 : Untransfected HEK293 cell lysate
    Lane 2 : RhoF transfected HEK293 cell lysate

    Predicted band size: 24 kDa

  • Flow cytometric analysis of Hela cells labeling RhoF using ab201976 at 1/200 dilution (green) and negative control (red).

References

ab201976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up