Overview

  • Product name

  • Description

    Rabbit polyclonal to RHOG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Hamster
  • Immunogen

    Recombinant fragment corresponding to Human RHOG aa 117-155.
    Sequence:

    KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL


    Database link: P84095

  • Positive control

    • IHC-P: Human tonsil tissue. WB: RT4, NIH/3T3 and NBT-II cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 21 kDa.

Target

  • Function

    Required for the formation of membrane ruffles during macropinocytosis. Required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHG antibody
    • Ras homolog family member G antibody
    • Rho G antibody
    • Rho related GTP binding protein RhoG precursor antibody
    • Rho-related GTP-binding protein RhoG antibody
    • RHOG antibody
    • RHOG_HUMAN antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for RHOG using ab224555 at 1/50 dilution in immunohistochemical analysis.

  • Anti-RHOG antibody (ab224555) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 21 kDa

  • All lanes : Anti-RHOG antibody (ab224555) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 21 kDa

References

ab224555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up