Overview

  • Product name

  • Description

    Rabbit polyclonal to RhoGDI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human RhoGDI aa 1-204.
    Sequence:

    MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRK YKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQ SFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG PRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKK DWKD


    Database link: P52565

  • Positive control

    • Jurkat, 293, A431, HeLa, HL60 and Mouse pancreas extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab175243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 23 kDa.

Target

Images

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175243. Blue DAPI for nuclear staining.
  • All lanes : Anti-RhoGDI antibody (ab175243) at 1/500 dilution

    Lane 1 : Jurkat cell line extract
    Lane 2 : 293 cell line extract
    Lane 3 : A431 cell line extract
    Lane 4 : HeLa cell line extract
    Lane 5 : HL60 cell line extract
    Lane 6 : Mouse pancreas extract

    Predicted band size: 23 kDa

References

ab175243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up