Overview

  • Product name

  • Description

    Rabbit polyclonal to RHOJ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human RHOJ aa 1-211. Full length mature chain without propeptide.
    Sequence:

    MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEY VPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICF SVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYM KEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKK KKRCSEGHSCC


    Database link: Q9H4E5

  • Positive control

    • IHC-P: Human liver cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    GTP-binding protein with GTPase activity. Elicits the formation of F-actin-rich structures in fibroblasts and is involved in the regulation of cell morphology.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHJ antibody
    • Ras homolog family member J antibody
    • Ras homolog gene family member J antibody
    • RAS like family 7 member B antibody
    • Ras like protein family member 7B antibody
    • Ras-like protein family member 7B antibody
    • RASL 7B antibody
    • RASL7B antibody
    • Rho related GTP binding protein RhoJ antibody
    • Rho-related GTP-binding protein RhoJ antibody
    • RHOI antibody
    • Rhoj antibody
    • RHOJ_HUMAN antibody
    • Tc10 like GTP binding protein TCL antibody
    • TC10 like Rho GTPase antibody
    • Tc10-like GTP-binding protein antibody
    • TC10B antibody
    • TCL antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for RHOJ with ab238497 at a 1/100 dilution in immunohistochemical analysis.

References

ab238497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up