Overview

  • Product name

  • Description

    Rabbit polyclonal to RIAM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RIAM aa 1-150.
    Sequence:

    MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFK DLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQ ASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLS


    Database link: Q7Z5R6

  • Positive control

    • IHC-P: Human breast cancer and tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    RIAM (Rap1-GTP interacting adapter molecule) appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling via interaction with profilin and VASP. It suppresses insulin-induced promoter activities through AP1 and SRE and also mediates Rap1-induced adhesion.
  • Cellular localization

    Cell Membrane, Cytoplasm and cytoskeleton
  • Database links

  • Alternative names

    • AB1IP antibody
    • Amyloid beta A4 precursor protein binding family B member 1 interacting protein antibody
    • Amyloid beta precursor protein binding family B member 1 antibody
    • APBB1 interacting protein 1 antibody
    • INAG1 antibody
    • OTTHUMP00000019344 antibody
    • PREL 1 antibody
    • PREL1 antibody
    • Proline rich EVH1 ligand 1 antibody
    • Proline rich protein 73 antibody
    • Rap1 GTP interacting adapter molecule antibody
    • RAP1 interacting adaptor molecule antibody
    • RARP 1 antibody
    • RARP1 antibody
    • Retinoic acid responsive proline rich protein 1 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for RIAM using ab238693 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for RIAM using ab238693 at 1/100 dilution in immunohistochemical analysis.

References

ab238693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up