Overview

  • Product name

  • Description

    Rabbit polyclonal to RIBC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RIBC2 aa 5-148.
    Sequence:

    DKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDL PARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREWKN ARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDF


    Database link: Q9H4K1

  • Positive control

    • IHC-P: Human fallopian tube tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similarities

    Belongs to the RIB43A family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4930579A10Rik antibody
    • C22orf11 antibody
    • MGC130587 antibody
    • RGD1309033 antibody
    • RIB43A domain with coiled-coils 2 antibody
    • RIB43A-like with coiled-coils protein 2 antibody
    • RIBC2 antibody
    • RIBC2_HUMAN antibody
    • Testis specific ribbon protein antibody
    • Trib antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human fallopian tube tissue stained for RIBC2 with ab243330 at 1/50 dilution in immunohistochemical analysis.

References

ab243330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up