Overview

  • Product name

    Anti-Ribonuclease Inhibitor/RAI antibody
    See all Ribonuclease Inhibitor/RAI primary antibodies
  • Description

    Rabbit polyclonal to Ribonuclease Inhibitor/RAI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Synthetic peptide within Human Ribonuclease Inhibitor/RAI aa 1-50. The exact sequence is proprietary.
    Sequence:

    MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISS


    Database link: P13489

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.
  • General notes

     This product was previously labelled as Ribonuclease Inhibitor

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab217132 was affinity purified using an epitope specific to Ribonuclease Inhibitor/RAI immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 50 kDa.

Target

  • Function

    Ribonuclease inhibitor which inhibits RNASE1, RNASE2 and ANG. May play role in redox homeostasis.
  • Sequence similarities

    Contains 15 LRR (leucine-rich) repeats.
  • Domain

    The LRR domain forms a horseshoe-shaped structure that interacts tightly with target RNAses via a large protein interaction surface on its interior side.
  • Post-translational
    modifications

    The N-terminus is blocked.
    At least 30 of the 32 cysteine residues are in the reduced form.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AW546468 antibody
    • C80305 antibody
    • MGC18200 antibody
    • MGC4569 antibody
    • MGC54054 antibody
    • OTTHUMP00000147628 antibody
    • OTTHUMP00000229864 antibody
    • OTTHUMP00000229865 antibody
    • OTTHUMP00000229866 antibody
    • OTTHUMP00000229870 antibody
    • OTTHUMP00000229871 antibody
    • OTTHUMP00000229872 antibody
    • Placental ribonuclease inhibitor antibody
    • Placental RNase inhibitor antibody
    • PRI antibody
    • RAI antibody
    • RI antibody
    • Ribonuclease inhibitor antibody
    • Ribonuclease/angiogenin inhibitor 1 antibody
    • Ribonuclease/angiogenin inhibitor antibody
    • RINI_HUMAN antibody
    • RNase inhibitor antibody
    • RNH 1 antibody
    • RNH antibody
    • RNH1 antibody
    • Rnh1 ribonuclease/angiogenin inhibitor 1 antibody
    see all

Images

  • All lanes : Anti-Ribonuclease Inhibitor/RAI antibody (ab217132) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 50 kDa


    Exposure time: 10 seconds


    Lysates were prepared using NETN lysis buffer.

  • Detection of Ribonuclease Inhibitor/RAI in immunoprecipitates of 293T whole cell lysate prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab217132 at 6 µg/mg lysate for IP (Lane 1) and at 0.4 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab217132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up