Overview

  • Product name

    Anti-Ribophorin I antibody
    See all Ribophorin I primary antibodies
  • Description

    Rabbit polyclonal to Ribophorin I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Dog, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Ribophorin I aa 308-438. Expressed in E. coli. N-terminal tag.
    Sequence:

    LDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVD HVFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRP VIVAYKKNLVEQHIQDIVVHYTFNKVLMLQE


    Database link: P04843

  • Positive control

    • WB: Recombinant human Ribophorin I protein; Pig stomach lysate; Human liver lysate; HeLa and BxPC-3 cell lysates. IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 69 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Ribophorin I using ab232954 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Ribophorin I antibody (ab232954) at 1 µg/ml + Pig stomach lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232954) at 1 µg/ml + Human liver lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232954) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232954) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232954) at 1 µg/ml + BxPC-3 (human pancreas adenocarcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232954) at 2 µg/ml + Recombinant human Ribophorin I protein

    Predicted band size: 69 kDa

References

ab232954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up