Overview

  • Product name

    Anti-Ribophorin I antibody
    See all Ribophorin I primary antibodies
  • Description

    Rabbit polyclonal to Ribophorin I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Dog, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Ribophorin I aa 24-179. (Expressed in E.coli).
    Sequence:

    ASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGGGSTSRATSFLLAL EPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVALDP GAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTM RVKLAS


    Database link: P04843

  • Positive control

    • WB: Recombinant human Ribophorin I protein; Pig pancreas lysate; HeLa cell lysate. IHC-P: Human liver, cerebrum, lung cancer and pancreas tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232992 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 69 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Ribophorin I at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for Ribophorin I at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human lung cancer tissue stained for Ribophorin I at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human pancreas tissue stained for Ribophorin I at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Ribophorin I antibody (ab232992) at 2 µg/ml + Recombinant human Ribophorin I protein

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232992) at 2 µg/ml + Pig pancreas lysate

    Predicted band size: 69 kDa

  • Anti-Ribophorin I antibody (ab232992) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 69 kDa

References

ab232992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up