Overview

  • Product name

    Anti-Ribophorin I antibody
    See all Ribophorin I primary antibodies
  • Description

    Rabbit polyclonal to Ribophorin I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Dog, Macaque monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Ribophorin I aa 180-307. (Expressed in E.coli).
    Sequence:

    RNVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITS MTRVIEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRS FKTILPAAAQDVYYRDEIGNVSTSHLLI


    Database link: P04843

  • Positive control

    • WB: Pig pancreas and stomach lysate; HeLa cell lysate; Recombinant human Ribophorin I protein. IHC-P: Human liver cancer, liver and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
  • Tissue specificity

    Expressed in all tissues tested.
  • Sequence similarities

    Belongs to the OST1 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links

  • Alternative names

    • D6Wsu137e antibody
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase 67 kDa subunit antibody
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase 67 kDa subunit precursor antibody
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit antibody
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 antibody
    • EC 2.4.1.119 antibody
    • Oligosaccharyltransferase 1 homolog antibody
    • oligosaccharyltransferase complex subunit (non-catalytic) antibody
    • OST1 antibody
    • RBPH1 antibody
    • Ribophorin I antibody
    • Ribophorin-1 antibody
    • RPN-I antibody
    • Rpn1 antibody
    • RPN1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin embedded human kidney tissue stained for Ribophorin I using ab233000 at 30 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin embedded human liver tissue stained for Ribophorin I using ab233000 at 30 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin embedded human liver cancer tissue stained for Ribophorin I using ab233000 at 30 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Ribophorin I antibody (ab233000) at 2 µg/ml + Recombinant human Ribophorin I protein
  • All lanes : Anti-Ribophorin I antibody (ab233000) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Pig pancreas tissue lysate
    Lane 3 : Pig stomach tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

References

ab233000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up