Overview

  • Product name

    Anti-RIC3 antibody
  • Description

    Rabbit polyclonal to RIC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RIC3 aa 118-197.
    Sequence:

    LSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLINR VGPNGERAQTVTSDQEKRLLHQLREITRVM


    Database link: Q7Z5B4-5

  • Positive control

    • Human pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Promotes functional expression of homomeric alpha-7 and alpha-8 nicotinic acetylcholine receptors at the cell surface. May also promote functional expression of homomeric serotoninergic 5-HT3 receptors, and of heteromeric acetylcholine receptors alpha-3/beta-2, alpha-3/beta-4, alpha-4/beta-2 and alpha-4/beta-4.
  • Tissue specificity

    Broadly expressed, with high levels in muscle, brain and heart. Over-expressed in brains from patients with bipolar disease or schizophrenia.
  • Sequence similarities

    Belongs to the ric-3 family.
  • Cellular localization

    Endoplasmic reticulum membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AYST720 antibody
    • FLJ11608 antibody
    • PRO1385 antibody
    • Protein RIC-3 antibody
    • Resistance to inhibitors of cholinesterase 3 homolog antibody
    • Resistant to inhibitor of cholinesterase 3 antibody
    • RIC3 acetylcholine receptor chaperone antibody
    • Ric3 antibody
    • RIC3_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling RIC3 with ab204786 at 1/50 dilution.

References

ab204786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up