Anti-RIC8B antibody (ab170006)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RIC8B antibody
See all RIC8B primary antibodies -
Description
Rabbit polyclonal to RIC8B -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human RIC8B aa 187-296.
Sequence:QGLPLLTQILESAFSIKWTDEYESAIDHNGPPLSPQETDCAIEALKALFN VTVDSWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLS NVPVSCLDVL
Database link: BC132689 -
Positive control
- HeLa and Human fetal brain lysates; Human fetal brain tissue.
Properties
-
Form
Lyophilised:Add 200 µl of steriled distilled water -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab170006 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/2000. Predicted molecular weight: 59 kDa. | |
IHC-P | 1/100 - 1/500. |
Target
-
Function
Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction. -
Sequence similarities
Belongs to the synembryn family. -
Cellular localization
Cytoplasm > cell cortex. Localizes to the cell cortex. - Information by UniProt
-
Database links
- Entrez Gene: 55188 Human
- Entrez Gene: 237422 Mouse
- Entrez Gene: 314681 Rat
- Omim: 609147 Human
- SwissProt: Q9NVN3 Human
- SwissProt: Q80XE1 Mouse
- SwissProt: Q80ZG0 Rat
- Unigene: 131306 Human
see all -
Alternative names
- Brain synembrin antibody
- brain synembryn antibody
- hSyn antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIC8B antibody (ab170006)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal brain tissue, labeling RIC8B with ab170006 at 1/100 dilution.
-
All lanes : Anti-RIC8B antibody (ab170006) at 1/1000 dilution
Lane 1 : Human fetal brain lysate
Lane 2 : HeLa cell lysate
Predicted band size: 59 kDa
References
ab170006 has not yet been referenced specifically in any publications.