Anti-RIC8B antibody (ab170006)
Key features and details
- Rabbit polyclonal to RIC8B
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RIC8B antibody
See all RIC8B primary antibodies -
Description
Rabbit polyclonal to RIC8B -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human RIC8B aa 187-296.
Sequence:QGLPLLTQILESAFSIKWTDEYESAIDHNGPPLSPQETDCAIEALKALFN VTVDSWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLS NVPVSCLDVL
Database link: BC132689 -
Positive control
- HeLa and Human fetal brain lysates; Human fetal brain tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Add 200 µl of steriled distilled water -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab170006 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/2000. Predicted molecular weight: 59 kDa. | |
| IHC-P | 1/100 - 1/500. |
Target
-
Function
Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction. -
Sequence similarities
Belongs to the synembryn family. -
Cellular localization
Cytoplasm > cell cortex. Localizes to the cell cortex. - Information by UniProt
-
Database links
- Entrez Gene: 55188 Human
- Entrez Gene: 237422 Mouse
- Entrez Gene: 314681 Rat
- Omim: 609147 Human
- SwissProt: Q9NVN3 Human
- SwissProt: Q80XE1 Mouse
- SwissProt: Q80ZG0 Rat
- Unigene: 131306 Human
see all -
Alternative names
- Brain synembrin antibody
- brain synembryn antibody
- hSyn antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIC8B antibody (ab170006)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal brain tissue, labeling RIC8B with ab170006 at 1/100 dilution.
-
Western blot - Anti-RIC8B antibody (ab170006)All lanes : Anti-RIC8B antibody (ab170006) at 1/1000 dilution
Lane 1 : Human fetal brain lysate
Lane 2 : HeLa cell lysate
Predicted band size: 59 kDa
Protocols
References (0)
ab170006 has not yet been referenced specifically in any publications.
