Overview

  • Product name

  • Description

    Rabbit polyclonal to RICH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RICH2 aa 685-810.
    Sequence:

    STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQ RPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHI ELGSTLRLSPLEHMRRHSVTDKRDSE


    Database link: Q17R89

  • Positive control

    • IHC: Human cerebral cortex tissue. WB: RT4 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 89 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    RICH2, Rho GTPase-activating protein interacting with CIP homologue protein 2, is a member Rho GTPase activating protein RICH family. This family of protein is one of the major regulators of Rho GTPases in all eukaryotes. In addition to their role as specific negative regulators of Rho protein signaling pathways, they are crucial in the differentiation, growth and organization of cell cytoskeleton, neuronal development and synaptic functions. RICH2 is located at mouse chromosome 11B3 and as a GTPase activator for the Rho-type GTPases, it converts them to an inactive GDP-bound state. Recent reports have identified RICH2 as a GTPase activator for Cdc42 and Rac1. RICH2 and different isoforms of RICH1 share two conserved domains, an N-terminal BAR domain and Rho/Rac/cdc42 GAP domain. The BAR domain of RICH2 binds membranes and is capable of inducing membrane tabulation. As a member of RICH family of proteins, RICH2 plays a crucial role in linking CD317/tetherin to the apical actin network. Knocking down the expression of RICH2 in cells usually results in loss of apical actin network. These cells exhibited similar characteristics that were seen in the CD317 knockdown cells. These characteristics include subsequent loss of apical microvilli, increase in actin bundles at the basal surface, reduction in cell height without any loss of tight junctions or transepithelial resistance or any change in the distribution of apical and basolateral marker proteins. Overexpression of RICH2 leads to a loss of Ras-induced membrane ruffles.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • KIAA0672 antibody
    • NPC A 10 antibody
    • Rho GTPase activating protein RICH2 antibody
    • Rho type GTPase activating protein RICH2 antibody
    • RhoGAP interacting with CIP4 homologs protein 2 antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for RICH2 using ab224165 at 1/200 dilution in immunohistochemical analysis.

  • Anti-RICH2 antibody (ab224165) at 1/200 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 89 kDa

References

ab224165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up