Overview

  • Product name

    Anti-RICS antibody
  • Description

    Rabbit polyclonal to RICS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RICS aa 1998-2087.
    Sequence:

    ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGT YVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE

  • Positive control

    • Human colon tissue.
  • General notes

    The antibody solution should be gently mixed before use.

    Previously labelled as ARHGAP32. 

Properties

Applications

Our Abpromise guarantee covers the use of ab150847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    RICS is a neuron-associated GTPase-activating protein that may regulate dendritic spine morphology and strength by modulating Rho GTPase
  • Cellular localization

    Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, dendritic spine By similarity. Cytoplasm, cell cortex. Endosome membrane By similarity. Golgi apparatus membrane By similarity. Endoplasmic reticulum membrane By similarity. Membrane.
  • Database links

  • Alternative names

    • ARHGAP32 antibody
    • Brain-specific Rho GTPase-activating protein antibody
    • GAB associated CDC42 antibody
    • GAB-associated Cdc42/Rac GTPase-activating protein antibody
    • GC-GAP antibody
    • GRIT antibody
    • GTPase activating protein for Cdc42 and Rac1 antibody
    • GTPase regulator interacting with TrkA antibody
    • KIAA0712, antibody
    • p200RhoGAP antibody
    • p250GAP antibody
    • PX-RICS antibody
    • rac GTPase activating protein antibody
    • Rho GTPase activating protein 32 antibody
    • Rho GTPase-activating protein 32 antibody
    • Rho-type GTPase-activating protein 32 antibody
    • Rho/Cdc42/Rac GTPase-activating protein RICS antibody
    • RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling antibody
    • RICS antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling RICS with ab1590847 at 1/50 dilution.

References

ab150847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer


Es freut mich zu hören, dass Sie unser Angebot unseren Antikörper ab150847 in WB zu testen, annehmen möchten. Wie am Telefon besprochen können Sie den Gutscheincode zum Kauf eines weiteren Antikörpers einsetzen, sobald Sie uns ein Abreview für diesen Antikörper eingereicht haben. Der Discountcode hat die Nummer ABTRIAL-12345, deckt den Wert von ab150847 ab und kann zum Kauf weiterer Produkte eingesetzt werden.

Der Code wird gültig, sobald Sie uns ein Abreview für diesen Antikörper über den Test in WB eingereicht haben. Bitte geben Sie diesen Code auch im Abschnitt “Additional Notes” des Abreviews mit an, so dass wir wissen, dass sich dieses Abreview auf die Gutscheinaktion bezieht. Der Code wird dadurch aktiviert. Bitte kontaktieren Sie bei der nächsten Bestellung unsere Kundendienst mit dem Code und der ursprünglichen Bestellnummer.

Bitte zögern Sie nicht, sich wieder an uns zu wenden, falls Sie weitere Fragen haben. Wir freuen uns auf Ihr Abreview, egal ob Ihre Ergebnisse positiv oder negativ sind und wünschen Ihnen viel Glück für Ihre Forschung.

Leider haben wir hier bei Abcam keine direkte Durchwahl, aber meine Kollegin Frau F.wird heute bis um 16:30 MEZ per Telefon unter 030 896 779 154 Position erreichbar sein. Fragen Sie einfach nach ihr, wir stellen Sie dann durch :)

Die Bedingungen dieses Angebotes befinden sich unter dem folgenden Link: www.abcam.com/collaborationdiscount

Read More

Answer



Das Rohrchen erhalten Sie, indem Sie meiner Kollegin Frau F. aus dem Kundendienst anrufen, da ich mit ihr Ihren Fall schon abgeklärt habe.

Wir nehmen jedes Produkt aus unserem Katalog, das im Test gegen das Immunogen durchfällt. Da es sich hier allerdings um ein Produkt handelt, welches wir nicht in unserem eigenen Labor produzieren, weiß ich leider nicht, ob wir den Antikörper wieder in unseren Katalog aufnehmen werden.

Unseres Wissens nach wurde ab150847 bisher noch nicht in WB getestet. Falls Sie dies selbst testen möchten, kann ich Ihnen zur Zeit ein spezielles Angebot über einen 100%igen Abreview-Rabatt anbieten. Bei diesem Angebot bekommen Sie einen Rabatt für eine zukünftige Bestellung, wenn Sie uns ein Abreview mit dem Testresultat zusenden. Der Rabatt würde gegen eine erneute Bestellung eines weiteren Produktes von uns verrechnet werden.

Um von diesem Angebot profitieren zu können, folgen Sie bitte diesen Schritten:

1.) Bestätigen Sie mir bitte, dass Sie ab150847 in WB testen möchten.

2.) Bitte bestellen Sie erst nach Erhalt des Rabattcodes.

3.) Bestellen Sie den Antikörper wie üblich per Telefon, Email oder Fax

4.) Testen Sie den Antikörper in WB

5.) Teilen Sie uns das Ergebnis Ihres Tests durch ein Abreview mit und notieren Sie den Discount Code in dem Feld "additional notes"
Unter der folgenden URL können Sie mehr über unser Abreview System erfahren:
https://www.abcam.com/abreviews

6.) Der Rabattcode ist nach dem Abschicken des Abreviews aktiv. Bitte beachten Sie, dass der Rabattcode innerhalb von 4 Monaten nach Ausstellung eingelöst werden muss.

Der Rabattcode wird gültig unabhängig davon, ob Ihr Ergebnis positiv oder negativ ist.

Die Bedingungen zu unserem 100% Abreview Rabatt können Sie unter dem folgenden Link nachlesen:
https://www.abcam.com/collaborationdiscount

Ich hoffe, diese Informationen helfen Ihnen weiter. Falls Sie einen Rabattcode erhalten möchten oder weitere Fragen haben, zögern Sie bitte nicht, sich wieder an mich zu wenden.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up