Overview

  • Product name

  • Description

    Rabbit polyclonal to RIDA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human RIDA aa 70-131.
    Sequence:

    GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGS RIEIEAVAIQGP


    Database link: P52758

  • Positive control

    • IHC-P: Human kidney tissue. WB: Human, mouse and rat liver lysates.
  • General notes

     This product was previously labelled as HRSP12

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 14 kDa.

Target

  • Function

    Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.
  • Tissue specificity

    Hepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues.
  • Sequence similarities

    Belongs to the RutC family.
  • Developmental stage

    Up-regulated during cellular differentiation.
  • Cellular localization

    Cytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • 14.5 kDa translational inhibitor protein antibody
    • 2-iminobutanoate/2-iminopropanoate deaminase antibody
    • Heat responsive protein 12 antibody
    • Heat-responsive protein 12 antibody
    • Hrsp12 antibody
    • p14.5 antibody
    • Perchloric acid soluble protein antibody
    • PSP antibody
    • Reactive intermediate imine deaminase A homolog antibody
    • Ribonuclease UK114 antibody
    • RIDA antibody
    • Translational inhibitor p14.5 antibody
    • Translational inhibitor protein p14.5 antibody
    • UK114 antibody
    • UK114 antigen homolog antibody
    • UK114_HUMAN antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for RIDA using ab224447 at 1/1000 dilution in immunohistochemical analysis.

  • All lanes : Anti-RIDA antibody (ab224447) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver lysate

    Predicted band size: 14 kDa

  • All lanes : Anti-RIDA antibody (ab224447) at 1/100 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Rat liver lysate

    Predicted band size: 14 kDa

References

ab224447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up