Anti-RIDA antibody - N-terminal (ab224443)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RIDA antibody - N-terminal
See all RIDA primary antibodies -
Description
Rabbit polyclonal to RIDA - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human RIDA aa 1-69 (N terminal).
Sequence:MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG VAEEAKQALKNMGEILKAA
Database link: P52758 -
Positive control
- IHC-P: Human liver tissue. WB: Human and rat liver lysates.
-
General notes
This product was previously labelled as HRSP12
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224443 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/250. Predicted molecular weight: 14 kDa. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA. -
Tissue specificity
Hepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues. -
Sequence similarities
Belongs to the RutC family. -
Developmental stage
Up-regulated during cellular differentiation. -
Cellular localization
Cytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear. - Information by UniProt
-
Database links
- Entrez Gene: 10247 Human
- Entrez Gene: 65151 Rat
- Omim: 602487 Human
- SwissProt: P52758 Human
- SwissProt: P52759 Rat
- Unigene: 18426 Human
- Unigene: 6987 Rat
-
Alternative names
- 14.5 kDa translational inhibitor protein antibody
- 2-iminobutanoate/2-iminopropanoate deaminase antibody
- Heat responsive protein 12 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIDA antibody - N-terminal (ab224443)Paraffin-embedded human liver tissue stained for RIDA using ab224443 at 1/50 dilution in immunohistochemical analysis.
-
Western blot - Anti-RIDA antibody - N-terminal (ab224443)All lanes : Anti-RIDA antibody - N-terminal (ab224443) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver lysate
Predicted band size: 14 kDa -
Western blot - Anti-RIDA antibody - N-terminal (ab224443)All lanes : Anti-RIDA antibody - N-terminal (ab224443) at 1/100 dilution
Lane 1 : Mouse liver lysate
Lane 2 : Rat liver lysate
Predicted band size: 14 kDa
Datasheets and documents
References
ab224443 has not yet been referenced specifically in any publications.
