Anti-RIDA antibody - N-terminal (ab224443)
Key features and details
- Rabbit polyclonal to RIDA - N-terminal
- Suitable for: WB, IHC-P
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-RIDA antibody - N-terminal
See all RIDA primary antibodies -
Description
Rabbit polyclonal to RIDA - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment corresponding to Human RIDA aa 1-69 (N terminal).
Sequence:MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG VAEEAKQALKNMGEILKAA
Database link: P52758 -
Positive control
- IHC-P: Human liver and kidney tissue. WB: Human and rat liver lysates.
-
General notes
This product was previously labelled as HRSP12
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224443 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 14 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA. -
Tissue specificity
Hepatocytes and renal distal tubular epithelial cells. Only weak expression in other tissues. -
Sequence similarities
Belongs to the RutC family. -
Developmental stage
Up-regulated during cellular differentiation. -
Cellular localization
Cytoplasm. Nucleus. Mostly cytoplasmic but, in less differentiated cells occasionally nuclear. - Information by UniProt
-
Database links
- Entrez Gene: 10247 Human
- Entrez Gene: 65151 Rat
- Omim: 602487 Human
- SwissProt: P52758 Human
- SwissProt: P52759 Rat
- Unigene: 18426 Human
- Unigene: 6987 Rat
-
Alternative names
- 14.5 kDa translational inhibitor protein antibody
- 2-iminobutanoate/2-iminopropanoate deaminase antibody
- Heat responsive protein 12 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIDA antibody - N-terminal (ab224443)
Paraffin-embedded human fallopian tube tissue stained for RIDA using ab224443 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIDA antibody - N-terminal (ab224443)
Paraffin-embedded human kidney tissue stained for RIDA using ab224443 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIDA antibody - N-terminal (ab224443)
Paraffin-embedded human skin tissue stained for RIDA using ab224443 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RIDA antibody - N-terminal (ab224443)
Paraffin-embedded human liver tissue stained for RIDA using ab224443 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-RIDA antibody - N-terminal (ab224443) at 1/100 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Lane 3 : Human plasma (IgG/HSA depleted)
Lane 4 : Human liver lysate
Predicted band size: 14 kDa -
All lanes : Anti-RIDA antibody - N-terminal (ab224443) at 1/100 dilution
Lane 1 : Mouse liver lysate
Lane 2 : Rat liver lysate
Predicted band size: 14 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224443 has not yet been referenced specifically in any publications.