Overview

  • Product name

    Anti-RING1 antibody [8E8A2]
    See all RING1 primary antibodies
  • Description

    Mouse monoclonal [8E8A2] to RING1
  • Host species

    Mouse
  • Tested applications

    Suitable for: ELISA, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human RING1 aa 79-263. Expressed in E. Coli.
    Sequence:

    SGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRL SRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGE GEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAG SEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIE


    Database link: Q06587

  • Positive control

    • RING1 recombinant protein; RING1 (aa 79-263)-hIgGFc transfected HEK293 cell lysate; A431 and HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    8E8A2
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000.
WB 1/500 - 1/2000. Predicted molecular weight: 42 kDa.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Constitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. Essential component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex act via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Compared to RNF2/RING2, it does not have the main E3 ubiquitin ligase activity on histone H2A, and it may rather act as a modulator of RNF2/RING2 activity.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Cellular localization

    Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ring1A antibody
    • E3 ubiquitin-protein ligase RING1 antibody
    • Polycomb complex protein RING1 antibody
    • Really interesting new gene 1 protein antibody
    • RING finger protein 1 antibody
    • Ring1 antibody
    • RING1_HUMAN antibody
    • RING1A antibody
    • Rnf1 antibody
    • Transcription repressor Ring1A antibody
    see all

Images

  • All lanes : Anti-RING1 antibody [8E8A2] (ab181756) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with RING1 (aa 79-263)-hIgGFc

    Predicted band size: 42 kDa

  • Anti-RING1 antibody [8E8A2] (ab181756) at 1/500 dilution + Human RING1 recombinant protein

    Predicted band size: 42 kDa

  • Immunofluorescent analysis of HeLa cells labeling RING1 with ab181756 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Immunofluorescent analysis of A431 cells labeling RING1 with ab181756 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

References

ab181756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up