Overview

  • Product name

    Anti-RINGO C antibody
  • Description

    Rabbit polyclonal to RINGO C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RINGO C aa 29-87.
    Sequence:

    SPLVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKD PCFQISDKY

  • Positive control

    • Human kidney tissue.
  • General notes

    Previously labelled as Speedy protein C. 

Properties

Applications

Our Abpromise guarantee covers the use of ab122597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Promotes progression through the cell cycle via binding and activation of CDK1 and CDK2.
  • Tissue specificity

    Expressed in a variety of tissues including bone marrow, kidney, small intestine, liver, placenta and testis.
  • Sequence similarities

    Belongs to the Speedy/Ringo family.
  • Domain

    The C-terminus is required for CDK2-activation, but not CDK2-binding.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • hSpy/Ringo C antibody
    • Rapid inducer of G2/M progression in oocytes C antibody
    • Rapid inducer of G2/M progression in oocytes, Xenopus, homolog of, C antibody
    • RINGO C antibody
    • Ringo2 antibody
    • SPDYC antibody
    • SPDYC_HUMAN antibody
    • speedy C antibody
    • speedy homolog C antibody
    • Speedy protein C antibody
    • Speedy, Xenopus, homolog of, C antibody
    see all

Images

  • ab122597, at 1/50 diluton, staining RINGO C in paraffin embedded Human kidney tissue by immunohistochemistry.

References

ab122597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up