Overview

  • Product name

  • Description

    Rabbit polyclonal to RIP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human RIP aa 1-656.
    Sequence:

    MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTG PNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNL MHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDF HIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLN DINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNV EEILEYCPREIISLMERCWQAIPEDRPTFLGIEEEFRPFYLSHFEEYVEE DVASLKKEYPDQSPVLQRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGLQM GPVEESWFSSSPEYPQDENDRSVQAKLQEEASYHAFGIFAEKQTKPQPRQ NEAYNREEERKRRVSHDPFAQQRARENIKSAGARGHSDPSTTSRGIAVQQ LSWPATQTVWNNGLYNQHGFGTTGTGVWYPPNLSQMYSTYKTPVPETNIP GSTPTMPYFSGPVADDLIKYTIFNSSGIQIGNHNYMDVGLNSQPPNNTCK EESTSRHQAIFDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEI DHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRIDLLNHL IRASQS


    Database link: Q60855

  • Positive control

    • IP: K562 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab234845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.

Target

  • Function

    Essential adapter molecule for the activation of NF-kappa-B. Following different upstream signals (binding of inflammatory cytokines, stimulation of pathogen recognition receptors, or DNA damage), particular RIPK1-containing complexes are formed, initiating a limited number of cellular responses. Upon TNFA stimulation RIPK1 is recruited to a TRADD-TRAF complex initiated by TNFR1 trimerization. There, it is ubiquitinated via 'Lys-63'-link chains, inducing its association with the IKK complex, and its activation through NEMO binding of polyubiquitin chains.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 death domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Proteolytically cleaved by caspase-8 during TNF-induced apoptosis. Cleavage abolishes NF-kappa-B activation and enhances pro-apototic signaling through the TRADD-FADD interaction.
    Autophosphorylated on serine and threonine residues.
    Ubiquitinated by 'Lys-11'-, 'Lys-48'-, 'Lys-63'- and linear-linked type ubiquitin. Polyubiquitination with 'Lys-63'-linked chains by TRAF2 induces association with the IKK complex. Deubiquitination of 'Lys-63'-linked chains and polyubiquitination with 'Lys-48'-linked chains by TNFAIP3 leads to RIPK1 proteasomal degradation and consequently to the termination of the TNF- or Linear polyubiquitinated; the head-to-tail polyubiquitination is mediated by the LUBAC complex. LPS-mediated activation of NF-kappa-B. Also ubiquitinated with 'Lys-11'-linked chains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell death protein RIP antibody
    • FLJ39204 antibody
    • OTTHUMP00000039163 antibody
    • Receptor (TNFRSF) interacting serine threonine kinase 1 antibody
    • receptor interacting protein 1 antibody
    • Receptor interacting protein antibody
    • Receptor interacting protein kinase 1 antibody
    • Receptor interacting serine threonine protein kinase 1 antibody
    • Receptor TNFRSF interacting serine threonine kinase 1 antibody
    • Receptor-interacting protein 1 antibody
    • Receptor-interacting serine/threonine-protein kinase 1 antibody
    • Rinp antibody
    • RIP 1 antibody
    • RIP antibody
    • Rip-1 antibody
    • RIP1 antibody
    • RIPK 1 antibody
    • Ripk1 antibody
    • RIPK1_HUMAN antibody
    • Serine threonine protein kinase RIP antibody
    • Serine/threonine-protein kinase RIP antibody
    see all

Images

  • RIP was immunoprecipitated from 500 μg of  K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate using ab234845 at 1/200 dilution. 

    Lane 1: Rabbit control IgG (1μg) instead of ab234845 in K562 whole cell lysate.
    Lane 2: ab234845 IP in K562 whole cell lysate (input).
    Lane 3: K562 whole cell lysate (10μg)

References

ab234845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up