Overview

  • Product name

  • Description

    Rabbit polyclonal to RIP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human RIP2 aa 450-500 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGE E


    Database link: O43353

  • Positive control

    • Rat lung tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab217549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Activates pro-caspase-1 and pro-caspase-8. Potentiates CASP8-mediated apoptosis. Activates NF-kappa-B.
  • Tissue specificity

    Detected in heart, brain, placenta, lung, peripheral blood leukocytes, spleen, kidney, testis, prostate, pancreas and lymph node.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 CARD domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination catalyzed by ITCH.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CARD 3 antibody
    • CARD carrying kinase antibody
    • CARD containing ICE associated kinase antibody
    • CARD containing IL 1 beta ICE kinase antibody
    • CARD containing IL1 beta ICE kinase antibody
    • CARD containing interleukin 1 beta converting enzyme (ICE) associated kinase antibody
    • CARD containing interleukin 1 beta converting enzyme associated kinase antibody
    • CARD-containing IL-1 beta ICE-kinase antibody
    • CARD-containing interleukin-1 beta-converting enzyme-associated kinase antibody
    • CARD3 antibody
    • CARDIAK antibody
    • CCK antibody
    • CLARP kinase antibody
    • GIG 30 antibody
    • GIG30 antibody
    • Growth inhibiting gene 30 antibody
    • Receptor interacting protein (RIP) like interacting caspase like apoptosis regulatory protein (CLARP) kinase antibody
    • Receptor interacting protein 2 antibody
    • Receptor interacting serine threonine kinase 2 antibody
    • Receptor interacting serine/threonine protein kinase 2 antibody
    • Receptor-interacting protein 2 antibody
    • Receptor-interacting serine/threonine-protein kinase 2 antibody
    • RICK antibody
    • RIP 2 antibody
    • RIP like interacting CLARP kinase antibody
    • RIP-2 antibody
    • RIP-like-interacting CLARP kinase antibody
    • RIPK 2 antibody
    • Ripk2 antibody
    • RIPK2_HUMAN antibody
    • TNFRSF antibody
    • Tyrosine-protein kinase RIPK2 antibody
    • UNQ277/PRO314/PRO34092 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat lung tissue, labeling RIP2 using ab217549 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up