
  • Product name
  • Description
    Rabbit polyclonal to RIPK4
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 734-783 (GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSK T) of Human RIPK4 (NP_065690)

  • Positive control
    • 293T cell lysate.


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab84365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 86 kDa (predicted molecular weight: 86 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    RIPK4 (receptor-interacting serine-threonine kinase 4) is a serine/threonine protein kinase which undergoes autophosphorylation. It can activate NFkappaB and is required for keratinocyte differentiation. It interacts with protein kinase C-delta (PRKCD).
  • Cellular localization
    Cytoplasm. Membrane; Peripheral membrane protein.
  • Database links
  • Form
    There are 2 isoforms produced by alternative splicing.
  • Alternative names
    • ANKK 2 antibody
    • ANKK2 antibody
    • ANKRD 3 antibody
    • ANKRD3 antibody
    • Ankyrin repeat domain 3 antibody
    • ankyrin repeat domain containing protein 3 antibody
    • Ankyrin repeat domain protein 3 antibody
    • DIK antibody
    • MGC129992 antibody
    • MGC129993 antibody
    • PKC delta interacting protein kinase antibody
    • PKK antibody
    • protein kinase C-associated kinase antibody
    • Receptor interacting serine threonine kinase 4 antibody
    • Receptor interacting serine/threonine protein kinase 4 antibody
    • RIP 4 antibody
    • RIP4 antibody
    • RIPK 4 antibody
    • Serine/threonine protein kinase ANKRD3 antibody
    see all


  • Anti-RIPK4 antibody (ab84365) at 1 µg/ml + 293T cell lysate at 10 µg

    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size: 86 kDa
    Observed band size: 86 kDa


ab84365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84365.
Please use the links above to contact us or submit feedback about this product.


Sign up