
  • Product name

    Anti-RIPK4 antibody
  • Description

    Rabbit polyclonal to RIPK4
  • Host species

  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 734-783 (GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSK T) of Human RIPK4 (NP_065690)

  • Positive control

    • 293T cell lysate.


  • Form

  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

  • Isotype

  • Research areas


Our Abpromise guarantee covers the use of ab84365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 86 kDa (predicted molecular weight: 86 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance

    RIPK4 (receptor-interacting serine-threonine kinase 4) is a serine/threonine protein kinase which undergoes autophosphorylation. It can activate NFkappaB and is required for keratinocyte differentiation. It interacts with protein kinase C-delta (PRKCD).
  • Cellular localization

    Cytoplasm. Membrane; Peripheral membrane protein.
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • ANKK 2 antibody
    • ANKK2 antibody
    • ANKRD 3 antibody
    • ANKRD3 antibody
    • Ankyrin repeat domain 3 antibody
    • ankyrin repeat domain containing protein 3 antibody
    • Ankyrin repeat domain protein 3 antibody
    • DIK antibody
    • MGC129992 antibody
    • MGC129993 antibody
    • PKC delta interacting protein kinase antibody
    • PKK antibody
    • protein kinase C-associated kinase antibody
    • Receptor interacting serine threonine kinase 4 antibody
    • Receptor interacting serine/threonine protein kinase 4 antibody
    • RIP 4 antibody
    • RIP4 antibody
    • RIPK 4 antibody
    • Serine/threonine protein kinase ANKRD3 antibody
    see all


  • Anti-RIPK4 antibody (ab84365) at 1 µg/ml + 293T cell lysate at 10 µg

    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size: 86 kDa
    Observed band size: 86 kDa


This product has been referenced in:

  • Zou L  et al. Influence of protein kinase RIPK4 expression on the apoptosis and proliferation of chondrocytes in osteoarthritis. Mol Med Rep 17:3078-3084 (2018). Read more (PubMed: 29257245) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84365.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up